Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8618
Gene name	Calcium dependent secretion activator
Gene symbol	CADPS
Synonyms (NCBI Gene)	CADPS1CAPSCAPS1UNC-31
Chromosome	3
Chromosome location	3p14.2
Summary	This gene encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves th

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	24906430
MIRT608230	hsa-miR-4643	HITS-CLIP	24906430
MIRT608229	hsa-miR-377-3p	HITS-CLIP	24906430
MIRT608228	hsa-miR-5096	HITS-CLIP	24906430
MIRT672808	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT672808	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT672808	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT672808	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT672808	hsa-miR-335-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608229	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608230	hsa-miR-4643	HITS-CLIP	27418678
MIRT608230	hsa-miR-4643	HITS-CLIP	27418678
MIRT608230	hsa-miR-4643	HITS-CLIP	27418678
MIRT608228	hsa-miR-5096	HITS-CLIP	27418678
MIRT608228	hsa-miR-5096	HITS-CLIP	27418678
MIRT608228	hsa-miR-5096	HITS-CLIP	27418678
MIRT608228	hsa-miR-5096	HITS-CLIP	27418678
MIRT608228	hsa-miR-5096	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	27418678
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608229	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT608228	hsa-miR-5096	HITS-CLIP	23824327
MIRT672808	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT608231	hsa-miR-8485	HITS-CLIP	23824327
MIRT608230	hsa-miR-4643	HITS-CLIP	23824327
MIRT609474	hsa-miR-8064	HITS-CLIP	23824327
MIRT858697	hsa-miR-103a	CLIP-seq
MIRT858698	hsa-miR-107	CLIP-seq
MIRT858699	hsa-miR-1183	CLIP-seq
MIRT858700	hsa-miR-1184	CLIP-seq
MIRT858701	hsa-miR-1205	CLIP-seq
MIRT858702	hsa-miR-124	CLIP-seq
MIRT858703	hsa-miR-1915	CLIP-seq
MIRT858704	hsa-miR-296-3p	CLIP-seq
MIRT858705	hsa-miR-3158-5p	CLIP-seq
MIRT858706	hsa-miR-3688-3p	CLIP-seq
MIRT858707	hsa-miR-3714	CLIP-seq
MIRT858708	hsa-miR-3910	CLIP-seq
MIRT858709	hsa-miR-3944-5p	CLIP-seq
MIRT858710	hsa-miR-3978	CLIP-seq
MIRT858711	hsa-miR-410	CLIP-seq
MIRT858712	hsa-miR-4666-5p	CLIP-seq
MIRT858713	hsa-miR-4802-3p	CLIP-seq
MIRT858714	hsa-miR-506	CLIP-seq
MIRT858715	hsa-miR-545	CLIP-seq
MIRT2495787	hsa-miR-136	CLIP-seq
MIRT2495788	hsa-miR-144	CLIP-seq
MIRT2495789	hsa-miR-186	CLIP-seq
MIRT2495790	hsa-miR-3133	CLIP-seq
MIRT2495791	hsa-miR-4790-3p	CLIP-seq
MIRT2495792	hsa-miR-515-5p	CLIP-seq
MIRT2495787	hsa-miR-136	CLIP-seq
MIRT2495788	hsa-miR-144	CLIP-seq
MIRT2495789	hsa-miR-186	CLIP-seq
MIRT2495790	hsa-miR-3133	CLIP-seq
MIRT2495791	hsa-miR-4790-3p	CLIP-seq
MIRT2495792	hsa-miR-515-5p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17984325, 25416956
GO:0005829	Component	Cytosol	TAS	1516133
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006887	Process	Exocytosis	TAS	1516133
GO:0008289	Function	Lipid binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045202	Component	Synapse	IEA
GO:0045921	Process	Positive regulation of exocytosis	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0099012	Component	Neuronal dense core vesicle membrane	IEA
GO:1990504	Process	Dense core granule exocytosis	IEA

MIM	HGNC	e!Ensembl
604667	1426	ENSG00000163618

Q9ULU8

Protein name

Calcium-dependent secretion activator 1 (Calcium-dependent activator protein for secretion 1) (CAPS-1)

Protein function

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates catecholamine loading of DCVs.

PDB

1WI1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	522 → 624	PH domain	Domain
PF06292	DUF1041	836 → 940	Domain of Unknown Function (DUF1041)	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in neural and endocrine secretory tissues. Expressed in brain and pancreas and at low level in heart. Also expressed in fetal heart, cerebellum, cerebral cortex, medulla, occipital pole, frontal and temporal lobe

Sequence

MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVG
AGGGGGSGASSGGGAGGLQPSSRAGGGRPSSPSPSVVSEKEKEELERLQKEEEERKKRLQ
LYVFVMRCIAYPFNAKQPTDMARRQQKISKQQLQTVKDRFQAFLNGETQIMADEAFMNAV
QSYYEVFLKSDRVARMVQSGGCSANDSREVFKKHIEKRVRSLPEIDGLSKETVLSSWMAK
FDAIYRGEEDPRKQQARMTASAASELILSKEQLYEMFQNILGIKKFEHQLLYNACQLDNP
DEQAAQIRRELDGRLQMADQIARERKFPKFVSKEMENMYIEELKSSVNLLMANLESMPVS
KGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVVLSFSLEVVIMEVQGLKSLAPNRIVY
CTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLALEDKELGRV
ILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWAIGKNVWKRWK
KRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGD
TVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQKLNAKGGNVPQLDAPISQFYADRA
QKHGMDEFISSNPCNFDHASLFEMVQRLTLDHRLNDSYSCLGWFSPGQVFVLDEYCARNG
VRGCHRHLCYLRDLLERAENGAMIDPTLLHYSFAFCASHVHGNRPDGIGTVTVEEKERFE
EIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPQEEVKTVIRK
CLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHH
AEPHVDKGEAFAWWSDLMVEHAETFLSLFAVDMDAALEVQPPDTWDSFPLFQLLNDFLRT
DYNLCNGKFHKHLQDLFAPLVVRYVDLMESSIAQSIHRGFERESWEPVKSLTSNLPNVNL
PNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDADNGSGTSEDLFWKLDALQTFIRD
LHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNV
MVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMITLLVAKFVTILEGVLAKLSRYD
EGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQ
WYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRN
RLTVEEATASVSEGGGLQGISMKDSDEEDEEDD

Sequence length

1353

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CADPS-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29522283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	GWASCAT_DG	30804558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16466630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20057284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29113272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21659380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	31638236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36916413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	30804558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28454255, 30742066, 31638236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31638236, 35817785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	25050926, 27267333, 30583465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29753254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Derealization	Derealization	BEFREE	31528271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30583465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30583465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31932636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	30529908, 31244621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20057284	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21305022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	17549010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASDB_DG	22605921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27688162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	GWASCAT_DG	26252872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed Syndrome	BEFREE	31741047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31119375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16551880, 22841674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	36916413	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29753254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28948699, 29911485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28948699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33790390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17549010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17549010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34389782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34659588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	31812994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27441461, 28549317, 28556998, 28594207, 28948699, 29038682, 29395872, 29441152, 29550742, 29576410, 29580220, 29685117, 29805779, 29911485, 30102064 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16551880, 22841674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29113272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34135559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	15059033, 16466630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	25050926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	27267333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28516235		★★★★★ ★☆☆☆☆ Found in Text Mining only

CADPS (calcium dependent secretion activator)