Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8615
Gene name	USO1 vesicle transport factor
Gene symbol	USO1
Synonyms (NCBI Gene)	P115TAPVDP
Chromosome	4
Chromosome location	4q21.1
Summary	The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates

270

Show/Hide all (270)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003825	hsa-miR-197-3p	Microarray	16822819
MIRT017638	hsa-miR-335-5p	Microarray	18185580
MIRT032299	hsa-let-7b-5p	Proteomics	18668040
MIRT039355	hsa-miR-421	CLASH	23622248
MIRT1477270	hsa-let-7a	CLIP-seq
MIRT1477271	hsa-let-7b	CLIP-seq
MIRT1477272	hsa-let-7c	CLIP-seq
MIRT1477273	hsa-let-7d	CLIP-seq
MIRT1477274	hsa-let-7e	CLIP-seq
MIRT1477275	hsa-let-7f	CLIP-seq
MIRT1477276	hsa-let-7g	CLIP-seq
MIRT1477277	hsa-let-7i	CLIP-seq
MIRT1477278	hsa-miR-1	CLIP-seq
MIRT1477279	hsa-miR-1208	CLIP-seq
MIRT1477280	hsa-miR-127-5p	CLIP-seq
MIRT1477281	hsa-miR-1293	CLIP-seq
MIRT1477282	hsa-miR-1305	CLIP-seq
MIRT1477283	hsa-miR-197	CLIP-seq
MIRT1477284	hsa-miR-202	CLIP-seq
MIRT1477285	hsa-miR-206	CLIP-seq
MIRT1477286	hsa-miR-23a	CLIP-seq
MIRT1477287	hsa-miR-23b	CLIP-seq
MIRT1477288	hsa-miR-23c	CLIP-seq
MIRT1477289	hsa-miR-3200-5p	CLIP-seq
MIRT1477290	hsa-miR-323-3p	CLIP-seq
MIRT1477291	hsa-miR-345	CLIP-seq
MIRT1477292	hsa-miR-3662	CLIP-seq
MIRT1477293	hsa-miR-3668	CLIP-seq
MIRT1477294	hsa-miR-3673	CLIP-seq
MIRT1477295	hsa-miR-3688-3p	CLIP-seq
MIRT1477296	hsa-miR-3688-5p	CLIP-seq
MIRT1477297	hsa-miR-374c	CLIP-seq
MIRT1477298	hsa-miR-412	CLIP-seq
MIRT1477299	hsa-miR-4291	CLIP-seq
MIRT1477300	hsa-miR-4310	CLIP-seq
MIRT1477301	hsa-miR-4420	CLIP-seq
MIRT1477302	hsa-miR-4458	CLIP-seq
MIRT1477303	hsa-miR-4483	CLIP-seq
MIRT1477304	hsa-miR-4500	CLIP-seq
MIRT1477305	hsa-miR-4684-3p	CLIP-seq
MIRT1477306	hsa-miR-4694-5p	CLIP-seq
MIRT1477307	hsa-miR-4705	CLIP-seq
MIRT1477308	hsa-miR-4778-3p	CLIP-seq
MIRT1477309	hsa-miR-518a-5p	CLIP-seq
MIRT1477310	hsa-miR-520d-5p	CLIP-seq
MIRT1477311	hsa-miR-522	CLIP-seq
MIRT1477312	hsa-miR-524-5p	CLIP-seq
MIRT1477313	hsa-miR-527	CLIP-seq
MIRT1477314	hsa-miR-532-5p	CLIP-seq
MIRT1477315	hsa-miR-545	CLIP-seq
MIRT1477316	hsa-miR-548aa	CLIP-seq
MIRT1477317	hsa-miR-548p	CLIP-seq
MIRT1477318	hsa-miR-561	CLIP-seq
MIRT1477319	hsa-miR-592	CLIP-seq
MIRT1477320	hsa-miR-597	CLIP-seq
MIRT1477321	hsa-miR-613	CLIP-seq
MIRT1477322	hsa-miR-655	CLIP-seq
MIRT1477323	hsa-miR-892a	CLIP-seq
MIRT1477324	hsa-miR-98	CLIP-seq
MIRT1477270	hsa-let-7a	CLIP-seq
MIRT1477271	hsa-let-7b	CLIP-seq
MIRT1477272	hsa-let-7c	CLIP-seq
MIRT1477273	hsa-let-7d	CLIP-seq
MIRT1477274	hsa-let-7e	CLIP-seq
MIRT1477275	hsa-let-7f	CLIP-seq
MIRT1477276	hsa-let-7g	CLIP-seq
MIRT1477277	hsa-let-7i	CLIP-seq
MIRT1477278	hsa-miR-1	CLIP-seq
MIRT2143738	hsa-miR-124	CLIP-seq
MIRT1477284	hsa-miR-202	CLIP-seq
MIRT1477285	hsa-miR-206	CLIP-seq
MIRT1477286	hsa-miR-23a	CLIP-seq
MIRT1477287	hsa-miR-23b	CLIP-seq
MIRT1477288	hsa-miR-23c	CLIP-seq
MIRT2143739	hsa-miR-320e	CLIP-seq
MIRT1477294	hsa-miR-3673	CLIP-seq
MIRT1477295	hsa-miR-3688-3p	CLIP-seq
MIRT2143740	hsa-miR-3689d	CLIP-seq
MIRT2143741	hsa-miR-3692	CLIP-seq
MIRT2143742	hsa-miR-3908	CLIP-seq
MIRT2143743	hsa-miR-3922-5p	CLIP-seq
MIRT2143744	hsa-miR-3942-5p	CLIP-seq
MIRT1477298	hsa-miR-412	CLIP-seq
MIRT2143745	hsa-miR-4263	CLIP-seq
MIRT2143746	hsa-miR-4307	CLIP-seq
MIRT1477301	hsa-miR-4420	CLIP-seq
MIRT1477302	hsa-miR-4458	CLIP-seq
MIRT1477304	hsa-miR-4500	CLIP-seq
MIRT2143747	hsa-miR-4703-5p	CLIP-seq
MIRT1477307	hsa-miR-4705	CLIP-seq
MIRT2143748	hsa-miR-4766-3p	CLIP-seq
MIRT1477308	hsa-miR-4778-3p	CLIP-seq
MIRT2143749	hsa-miR-4799-5p	CLIP-seq
MIRT2143750	hsa-miR-4802-5p	CLIP-seq
MIRT2143751	hsa-miR-506	CLIP-seq
MIRT2143752	hsa-miR-513a-3p	CLIP-seq
MIRT1477318	hsa-miR-561	CLIP-seq
MIRT2143753	hsa-miR-576-3p	CLIP-seq
MIRT2143754	hsa-miR-576-5p	CLIP-seq
MIRT2143755	hsa-miR-587	CLIP-seq
MIRT1477321	hsa-miR-613	CLIP-seq
MIRT2143756	hsa-miR-676	CLIP-seq
MIRT1477324	hsa-miR-98	CLIP-seq
MIRT1477270	hsa-let-7a	CLIP-seq
MIRT1477271	hsa-let-7b	CLIP-seq
MIRT1477272	hsa-let-7c	CLIP-seq
MIRT1477273	hsa-let-7d	CLIP-seq
MIRT1477274	hsa-let-7e	CLIP-seq
MIRT1477275	hsa-let-7f	CLIP-seq
MIRT1477276	hsa-let-7g	CLIP-seq
MIRT1477277	hsa-let-7i	CLIP-seq
MIRT1477278	hsa-miR-1	CLIP-seq
MIRT1477279	hsa-miR-1208	CLIP-seq
MIRT2143738	hsa-miR-124	CLIP-seq
MIRT1477281	hsa-miR-1293	CLIP-seq
MIRT2364038	hsa-miR-1303	CLIP-seq
MIRT1477282	hsa-miR-1305	CLIP-seq
MIRT2364039	hsa-miR-193a-5p	CLIP-seq
MIRT1477284	hsa-miR-202	CLIP-seq
MIRT1477285	hsa-miR-206	CLIP-seq
MIRT1477286	hsa-miR-23a	CLIP-seq
MIRT1477287	hsa-miR-23b	CLIP-seq
MIRT1477288	hsa-miR-23c	CLIP-seq
MIRT2364040	hsa-miR-3074-3p	CLIP-seq
MIRT2143739	hsa-miR-320e	CLIP-seq
MIRT1477290	hsa-miR-323-3p	CLIP-seq
MIRT2364041	hsa-miR-365	CLIP-seq
MIRT1477293	hsa-miR-3668	CLIP-seq
MIRT1477294	hsa-miR-3673	CLIP-seq
MIRT1477295	hsa-miR-3688-3p	CLIP-seq
MIRT1477296	hsa-miR-3688-5p	CLIP-seq
MIRT2143740	hsa-miR-3689d	CLIP-seq
MIRT1477297	hsa-miR-374c	CLIP-seq
MIRT2143743	hsa-miR-3922-5p	CLIP-seq
MIRT1477298	hsa-miR-412	CLIP-seq
MIRT2143745	hsa-miR-4263	CLIP-seq
MIRT1477300	hsa-miR-4310	CLIP-seq
MIRT2364042	hsa-miR-4328	CLIP-seq
MIRT1477301	hsa-miR-4420	CLIP-seq
MIRT1477302	hsa-miR-4458	CLIP-seq
MIRT2364043	hsa-miR-4477b	CLIP-seq
MIRT1477303	hsa-miR-4483	CLIP-seq
MIRT1477304	hsa-miR-4500	CLIP-seq
MIRT1477305	hsa-miR-4684-3p	CLIP-seq
MIRT1477307	hsa-miR-4705	CLIP-seq
MIRT1477308	hsa-miR-4778-3p	CLIP-seq
MIRT2143750	hsa-miR-4802-5p	CLIP-seq
MIRT2364044	hsa-miR-487a	CLIP-seq
MIRT2364045	hsa-miR-499-3p	CLIP-seq
MIRT2364046	hsa-miR-499a-3p	CLIP-seq
MIRT2143751	hsa-miR-506	CLIP-seq
MIRT1477309	hsa-miR-518a-5p	CLIP-seq
MIRT1477310	hsa-miR-520d-5p	CLIP-seq
MIRT1477312	hsa-miR-524-5p	CLIP-seq
MIRT1477313	hsa-miR-527	CLIP-seq
MIRT1477316	hsa-miR-548aa	CLIP-seq
MIRT1477318	hsa-miR-561	CLIP-seq
MIRT2143755	hsa-miR-587	CLIP-seq
MIRT1477321	hsa-miR-613	CLIP-seq
MIRT1477322	hsa-miR-655	CLIP-seq
MIRT2143756	hsa-miR-676	CLIP-seq
MIRT2364047	hsa-miR-759	CLIP-seq
MIRT1477323	hsa-miR-892a	CLIP-seq
MIRT1477324	hsa-miR-98	CLIP-seq
MIRT1477270	hsa-let-7a	CLIP-seq
MIRT1477271	hsa-let-7b	CLIP-seq
MIRT1477272	hsa-let-7c	CLIP-seq
MIRT1477273	hsa-let-7d	CLIP-seq
MIRT1477274	hsa-let-7e	CLIP-seq
MIRT1477275	hsa-let-7f	CLIP-seq
MIRT1477276	hsa-let-7g	CLIP-seq
MIRT1477277	hsa-let-7i	CLIP-seq
MIRT1477278	hsa-miR-1	CLIP-seq
MIRT1477284	hsa-miR-202	CLIP-seq
MIRT1477285	hsa-miR-206	CLIP-seq
MIRT1477294	hsa-miR-3673	CLIP-seq
MIRT1477295	hsa-miR-3688-3p	CLIP-seq
MIRT1477298	hsa-miR-412	CLIP-seq
MIRT1477301	hsa-miR-4420	CLIP-seq
MIRT1477302	hsa-miR-4458	CLIP-seq
MIRT1477304	hsa-miR-4500	CLIP-seq
MIRT1477308	hsa-miR-4778-3p	CLIP-seq
MIRT2143753	hsa-miR-576-3p	CLIP-seq
MIRT1477321	hsa-miR-613	CLIP-seq
MIRT1477324	hsa-miR-98	CLIP-seq
MIRT2434459	hsa-miR-150	CLIP-seq
MIRT1477299	hsa-miR-4291	CLIP-seq
MIRT2434460	hsa-miR-4764-3p	CLIP-seq
MIRT1477315	hsa-miR-545	CLIP-seq
MIRT1477317	hsa-miR-548p	CLIP-seq
MIRT2657754	hsa-miR-105	CLIP-seq
MIRT2657755	hsa-miR-1245b-3p	CLIP-seq
MIRT2657756	hsa-miR-1246	CLIP-seq
MIRT1477280	hsa-miR-127-5p	CLIP-seq
MIRT2657757	hsa-miR-1290	CLIP-seq
MIRT2657758	hsa-miR-1302	CLIP-seq
MIRT1477282	hsa-miR-1305	CLIP-seq
MIRT2434459	hsa-miR-150	CLIP-seq
MIRT2364039	hsa-miR-193a-5p	CLIP-seq
MIRT1477283	hsa-miR-197	CLIP-seq
MIRT2657759	hsa-miR-3122	CLIP-seq
MIRT2657760	hsa-miR-3129-3p	CLIP-seq
MIRT2657761	hsa-miR-3134	CLIP-seq
MIRT2657762	hsa-miR-3140-3p	CLIP-seq
MIRT2657763	hsa-miR-3167	CLIP-seq
MIRT1477292	hsa-miR-3662	CLIP-seq
MIRT2657764	hsa-miR-3913-5p	CLIP-seq
MIRT2657765	hsa-miR-3914	CLIP-seq
MIRT2657766	hsa-miR-3942-3p	CLIP-seq
MIRT1477299	hsa-miR-4291	CLIP-seq
MIRT2657767	hsa-miR-4298	CLIP-seq
MIRT2143746	hsa-miR-4307	CLIP-seq
MIRT2364042	hsa-miR-4328	CLIP-seq
MIRT2364043	hsa-miR-4477b	CLIP-seq
MIRT2657768	hsa-miR-450b-5p	CLIP-seq
MIRT2657769	hsa-miR-4517	CLIP-seq
MIRT2657770	hsa-miR-4521	CLIP-seq
MIRT2657771	hsa-miR-4680-3p	CLIP-seq
MIRT1477306	hsa-miR-4694-5p	CLIP-seq
MIRT2657772	hsa-miR-4728-3p	CLIP-seq
MIRT2657773	hsa-miR-4735-5p	CLIP-seq
MIRT2434460	hsa-miR-4764-3p	CLIP-seq
MIRT2657774	hsa-miR-4803	CLIP-seq
MIRT2364044	hsa-miR-487a	CLIP-seq
MIRT1477309	hsa-miR-518a-5p	CLIP-seq
MIRT1477311	hsa-miR-522	CLIP-seq
MIRT1477313	hsa-miR-527	CLIP-seq
MIRT1477314	hsa-miR-532-5p	CLIP-seq
MIRT1477315	hsa-miR-545	CLIP-seq
MIRT2657775	hsa-miR-548a-3p	CLIP-seq
MIRT2657776	hsa-miR-548e	CLIP-seq
MIRT2657777	hsa-miR-548f	CLIP-seq
MIRT1477317	hsa-miR-548p	CLIP-seq
MIRT2143753	hsa-miR-576-3p	CLIP-seq
MIRT2657778	hsa-miR-656	CLIP-seq
MIRT2657779	hsa-miR-876-5p	CLIP-seq
MIRT2657780	hsa-miR-888	CLIP-seq
MIRT2657754	hsa-miR-105	CLIP-seq
MIRT2657755	hsa-miR-1245b-3p	CLIP-seq
MIRT2657756	hsa-miR-1246	CLIP-seq
MIRT1477280	hsa-miR-127-5p	CLIP-seq
MIRT2657757	hsa-miR-1290	CLIP-seq
MIRT2657758	hsa-miR-1302	CLIP-seq
MIRT2434459	hsa-miR-150	CLIP-seq
MIRT1477283	hsa-miR-197	CLIP-seq
MIRT2657759	hsa-miR-3122	CLIP-seq
MIRT2657760	hsa-miR-3129-3p	CLIP-seq
MIRT2657761	hsa-miR-3134	CLIP-seq
MIRT2657762	hsa-miR-3140-3p	CLIP-seq
MIRT2657763	hsa-miR-3167	CLIP-seq
MIRT1477292	hsa-miR-3662	CLIP-seq
MIRT2657764	hsa-miR-3913-5p	CLIP-seq
MIRT2657766	hsa-miR-3942-3p	CLIP-seq
MIRT1477299	hsa-miR-4291	CLIP-seq
MIRT2657767	hsa-miR-4298	CLIP-seq
MIRT2657768	hsa-miR-450b-5p	CLIP-seq
MIRT2657770	hsa-miR-4521	CLIP-seq
MIRT1477306	hsa-miR-4694-5p	CLIP-seq
MIRT2657772	hsa-miR-4728-3p	CLIP-seq
MIRT2657773	hsa-miR-4735-5p	CLIP-seq
MIRT2434460	hsa-miR-4764-3p	CLIP-seq
MIRT1477309	hsa-miR-518a-5p	CLIP-seq
MIRT1477311	hsa-miR-522	CLIP-seq
MIRT1477313	hsa-miR-527	CLIP-seq
MIRT1477314	hsa-miR-532-5p	CLIP-seq
MIRT1477315	hsa-miR-545	CLIP-seq
MIRT1477317	hsa-miR-548p	CLIP-seq
MIRT2143753	hsa-miR-576-3p	CLIP-seq
MIRT2657779	hsa-miR-876-5p	CLIP-seq
MIRT2657780	hsa-miR-888	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS	9478999
GO:0001650	Component	Fibrillar center	IDA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	25416956, 33961781, 36217029
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IBA
GO:0005815	Component	Microtubule organizing center	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	ISS
GO:0007030	Process	Golgi organization	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	IBA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030133	Component	Transport vesicle	TAS
GO:0032252	Process	Secretory granule localization	IEA
GO:0045056	Process	Transcytosis	IBA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048193	Process	Golgi vesicle transport	IEA
GO:0048211	Process	Golgi vesicle docking	IBA
GO:0048280	Process	Vesicle fusion with Golgi apparatus	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0061025	Process	Membrane fusion	IBA
GO:1900076	Process	Regulation of cellular response to insulin stimulus	IEA

MIM	HGNC	e!Ensembl
603344	30904	ENSG00000138768

O60763

Protein name

General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis-associated protein) (TAP) (Vesicle-docking protein)

Protein function

General vesicular transport factor required for intercisternal transport in the Golgi stack; it is required for transcytotic fusion and/or subsequent binding of the vesicles to the target membrane. May well act as a vesicular anchor by interacti

PDB

2W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18770	Arm_vescicular	269 → 329	Armadillo tether-repeat of vescicular transport factor	Repeat
PF04869	Uso1_p115_head	344 → 628	Uso1 / p115 like vesicle tethering protein, head region	Family
PF04871	Uso1_p115_C	784 → 954	Uso1 / p115 like vesicle tethering protein, C terminal region	Family

Sequence

MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQ
AMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIKQ
QENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIILVSPMGVSRLMDLLADSRE
VIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIISEEGNSDGGIVVEDCLILLQNLL
KNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGAT
SSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNP
PRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVS
AGQLLCGGLFSTDSLSNWCAAVALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTN
ILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGL
CALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPN
FPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIR
EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSE
GAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVS
ARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIA
TKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEIT
DSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLD
HI

Sequence length

962

Interactions

View interactions

	Reactome
			COPII-mediated vesicle transport COPI-mediated anterograde transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USO1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (103)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17982230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	8727210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	17082617, 19404951, 19480848, 25187574, 28405734, 7652740, 8311558, 8770637, 8912512, 9864038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	30671804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	8911997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29313707, 30910637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	12660803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	14551602, 8847232, 9278325, 9326638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	12149238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome, Type I	Bare Lymphocyte Syndrome	BEFREE	12149238, 12644316, 7517574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12911283, 7794046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	12149238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28860053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19909011, 27017207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11513878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	17245734, 21796142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14984960, 17382375, 18316574, 19909011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25667220, 7707419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	8045794, 8344720, 9129973, 9548076		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14984960, 19188174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	24288424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14984960, 17382375, 19188174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	26382629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26184508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	12660803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12738726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	8732477, 9361175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	18433405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29698251, 30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	7916022, 8543762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29343547, 7578413, 7903260, 7911550, 8052140, 8248212, 8988536, 9129974, 9226129, 9250458, 9548077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse Panbronchiolitis	BEFREE	10323341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	16191421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	7916022, 8543762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	12911283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15774487, 26205887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26205887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	15887980, 23401652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	18668571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	9027960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11781255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	9361175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	8181963, 8203956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	21440064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	17940597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22025554, 30504837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19387463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7774641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19909011, 27017207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26205887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25667220, 7707419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29355559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16541432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26205887, 28610992, 29507106, 29710479, 31074096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14984960, 19188174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26184508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	23662797, 28161407, 30189467		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10360639, 18385764, 8851724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21343389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21159167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26898451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	7929801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	9062975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14984960, 16140964, 18316574, 19188174, 19243822, 22298786, 23302073, 28610992, 29341428, 29355559, 31434881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11260505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27098790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19909011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17302733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31560756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27098790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	18668571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	16690408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29698251, 30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	30189467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29355559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16787920	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29580912		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	12648225, 15306733, 17581627, 8911997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	9712355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12738726, 9816317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	21440064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10689121, 7728393, 8162639, 9536820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10471632, 8882407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15318034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12911283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30035341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15814633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16541432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11513878, 24379579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16112028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	9115580, 9361175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36705569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	17940597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	14551602		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	14551602		★★★★★ ★☆☆☆☆ Found in Text Mining only

USO1 (USO1 vesicle transport factor)