Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8613
Gene name	Phospholipid phosphatase 3
Gene symbol	PLPP3
Synonyms (NCBI Gene)	Dri42LPP3PAP2BPPAP2BVCIP
Chromosome	1
Chromosome location	1p32.2
Summary	The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction media

142

Show/Hide all (142)

miRTarBase ID	miRNA	Experiments	Reference
MIRT700684	hsa-miR-122-3p	HITS-CLIP	23313552
MIRT700683	hsa-miR-6887-3p	HITS-CLIP	23313552
MIRT700682	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT700681	hsa-miR-4532	HITS-CLIP	23313552
MIRT678366	hsa-miR-562	HITS-CLIP	23824327
MIRT678365	hsa-miR-625-3p	HITS-CLIP	23824327
MIRT678364	hsa-miR-1295b-3p	HITS-CLIP	23824327
MIRT678363	hsa-miR-5697	HITS-CLIP	23824327
MIRT678362	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT678361	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT678360	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT678359	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT678358	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678357	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT678356	hsa-miR-1976	HITS-CLIP	23824327
MIRT678355	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678354	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT678353	hsa-miR-3199	HITS-CLIP	23824327
MIRT678352	hsa-miR-8052	HITS-CLIP	23824327
MIRT678351	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT678350	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT678349	hsa-miR-4279	HITS-CLIP	23824327
MIRT632564	hsa-miR-340-3p	HITS-CLIP	23824327
MIRT632563	hsa-miR-6827-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT627834	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT632564	hsa-miR-340-3p	HITS-CLIP	23824327
MIRT632563	hsa-miR-6827-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT627834	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT627834	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT627834	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT622638	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT622637	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT622636	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622635	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622634	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622633	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622632	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT555437	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT555436	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT555435	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT555434	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT555433	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT555432	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT555431	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542781	hsa-miR-4644	PAR-CLIP	21572407
MIRT542780	hsa-miR-4306	PAR-CLIP	21572407
MIRT542779	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT542778	hsa-miR-4262	PAR-CLIP	21572407
MIRT542777	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT542776	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT542775	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT542774	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT555430	hsa-miR-4511	PAR-CLIP	21572407
MIRT555429	hsa-miR-2278	PAR-CLIP	21572407
MIRT555428	hsa-miR-451b	PAR-CLIP	21572407
MIRT542773	hsa-miR-3162-3p	PAR-CLIP	21572407
MIRT542772	hsa-miR-4502	PAR-CLIP	21572407
MIRT542771	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT542770	hsa-miR-5186	PAR-CLIP	21572407
MIRT542769	hsa-miR-5192	PAR-CLIP	21572407
MIRT542768	hsa-miR-6883-3p	PAR-CLIP	21572407
MIRT542767	hsa-miR-4531	PAR-CLIP	21572407
MIRT542766	hsa-miR-1270	PAR-CLIP	21572407
MIRT542765	hsa-miR-620	PAR-CLIP	21572407
MIRT542764	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT542763	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT542762	hsa-miR-4446-5p	PAR-CLIP	21572407
MIRT542781	hsa-miR-4644	PAR-CLIP	21572407
MIRT542780	hsa-miR-4306	PAR-CLIP	21572407
MIRT542779	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT542778	hsa-miR-4262	PAR-CLIP	21572407
MIRT542777	hsa-miR-181a-5p	PAR-CLIP	21572407
MIRT542776	hsa-miR-181c-5p	PAR-CLIP	21572407
MIRT542775	hsa-miR-181d-5p	PAR-CLIP	21572407
MIRT542774	hsa-miR-181b-5p	PAR-CLIP	21572407
MIRT542773	hsa-miR-3162-3p	PAR-CLIP	21572407
MIRT542772	hsa-miR-4502	PAR-CLIP	21572407
MIRT542771	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT542770	hsa-miR-5186	PAR-CLIP	21572407
MIRT542769	hsa-miR-5192	PAR-CLIP	21572407
MIRT542768	hsa-miR-6883-3p	PAR-CLIP	21572407
MIRT542767	hsa-miR-4531	PAR-CLIP	21572407
MIRT542766	hsa-miR-1270	PAR-CLIP	21572407
MIRT542765	hsa-miR-620	PAR-CLIP	21572407
MIRT542764	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT542763	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT542762	hsa-miR-4446-5p	PAR-CLIP	21572407

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001702	Process	Gastrulation with mouth forming second	IEA
GO:0005178	Function	Integrin binding	IDA	12660161
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	20123964
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	23591818
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	23591818
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IDA	20123964
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IBA
GO:0006644	Process	Phospholipid metabolic process	IDA	9305923, 9705349
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	9305923, 9705349
GO:0006672	Process	Ceramide metabolic process	IDA	9305923, 9705349
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	23591818
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	12660161
GO:0008195	Function	Phosphatidate phosphatase activity	IBA
GO:0008195	Function	Phosphatidate phosphatase activity	IDA	9305923, 9705349
GO:0008195	Function	Phosphatidate phosphatase activity	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	20123964
GO:0016020	Component	Membrane	IDA	9305923, 9705349
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	14527693
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030149	Process	Sphingolipid catabolic process	TAS
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	23591818
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0033631	Process	Cell-cell adhesion mediated by integrin	IDA	12660161
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IMP	20123964
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IBA
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IDA	9305923, 9705349
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IEA
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	TAS
GO:0042577	Function	Lipid phosphatase activity	IEA
GO:0045121	Component	Membrane raft	IDA	17005594
GO:0045121	Component	Membrane raft	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20123964
GO:0046839	Process	Phospholipid dephosphorylation	IBA
GO:0046839	Process	Phospholipid dephosphorylation	IDA	9305923, 9705349
GO:0050821	Process	Protein stabilization	IDA	20123964
GO:0050821	Process	Protein stabilization	IEA
GO:0060020	Process	Bergmann glial cell differentiation	IEA
GO:0070097	Function	Delta-catenin binding	IPI	20123964
GO:0070971	Component	Endoplasmic reticulum exit site	IDA	23591818
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0106235	Function	Ceramide-1-phosphate phosphatase activity	IDA	9705349
GO:1902068	Process	Regulation of sphingolipid mediated signaling pathway	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	20123964
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IDA	20123964
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IEA

MIM	HGNC	e!Ensembl
607125	9229	ENSG00000162407

O14495

Protein name

Phospholipid phosphatase 3 (EC 3.1.3.-) (EC 3.1.3.4) (Lipid phosphate phosphohydrolase 3) (PAP2-beta) (Phosphatidate phosphohydrolase type 2b) (Phosphatidic acid phosphatase 2b) (PAP-2b) (PAP2b) (Vascular endothelial growth factor and type I collagen-indu

Protein function

Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosp

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	129 → 279	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:12660161, PubMed:9305923). Highly expressed in heart and placenta (PubMed:9305923). {ECO:0000269|PubMed:12660161, ECO:0000269|PubMed:9305923}.

Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM

Sequence length

311

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Ether lipid metabolism Sphingolipid metabolism Metabolic pathways Phospholipase D signaling pathway Fc gamma R-mediated phagocytosis Fat digestion and absorption Choline metabolism in cancer		Sphingolipid de novo biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METASTATIC COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aortic valve disorder	Aortic Valve Disease	BEFREE	29726894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23104851, 28291223, 29518748, 30003117, 31362988, 31533471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23104851, 28291223, 29518748, 30003117, 31362988, 31533471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27694435, 31362988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29518748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30429326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	24262325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21569306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28982073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23104851, 25835000, 28061459, 28291223, 29518748, 31362988, 31533471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	23104851, 25835000, 26034042, 28061459, 28291223, 29518748, 30429326, 31362988, 31533471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125, 24262325		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24795506, 25835000, 27694435, 30429326, 31362988	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778, 30104761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28061459, 29848931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21378988, 21378990, 21846871		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21378988, 21378990, 21846871, 24262325		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	23104851, 25835000, 28061459, 28291223, 29518748, 29848931, 31362988, 31533471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28812028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34134627	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21569306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21569306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28982073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	30429326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24518713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31546971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASCAT_DG	26343387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12615725, 21569306, 28135860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27376874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27694435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	31362988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLPP3 (phospholipid phosphatase 3)