RGS20 (regulator of G protein signaling 20)

Gene

• Entrez ID: 8601
• Gene name: Regulator of G protein signaling 20
• Gene symbol: RGS20
• Synonyms (NCBI Gene): RGSZ1, ZGAP1, g(z)GAP, gz-GAP
• Chromosome: 8
• Chromosome location: 8q11.23
• Summary: The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the G

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028834	hsa-miR-26b-5p	Microarray	19088304
MIRT1304299	hsa-miR-548c-3p	CLIP-seq
MIRT1304300	hsa-miR-1287	CLIP-seq
MIRT1304301	hsa-miR-140-5p	CLIP-seq
MIRT1304302	hsa-miR-204	CLIP-seq
MIRT1304303	hsa-miR-211	CLIP-seq
MIRT1304304	hsa-miR-3121-5p	CLIP-seq
MIRT1304305	hsa-miR-3135b	CLIP-seq
MIRT1304306	hsa-miR-3165	CLIP-seq
MIRT1304307	hsa-miR-3187-3p	CLIP-seq
MIRT1304308	hsa-miR-3194-3p	CLIP-seq
MIRT1304309	hsa-miR-3614-3p	CLIP-seq
MIRT1304310	hsa-miR-3668	CLIP-seq
MIRT1304311	hsa-miR-4252	CLIP-seq
MIRT1304312	hsa-miR-4299	CLIP-seq
MIRT1304313	hsa-miR-4435	CLIP-seq
MIRT1304314	hsa-miR-4456	CLIP-seq
MIRT1304315	hsa-miR-4520a-3p	CLIP-seq
MIRT1304316	hsa-miR-4638-3p	CLIP-seq
MIRT1304317	hsa-miR-4701-5p	CLIP-seq
MIRT1304318	hsa-miR-4755-5p	CLIP-seq
MIRT1304319	hsa-miR-4796-3p	CLIP-seq
MIRT1304320	hsa-miR-548q	CLIP-seq
MIRT1304321	hsa-miR-548s	CLIP-seq
MIRT1304322	hsa-miR-549	CLIP-seq
MIRT1304323	hsa-miR-588	CLIP-seq
MIRT1304324	hsa-miR-623	CLIP-seq
MIRT1304325	hsa-miR-885-5p	CLIP-seq
MIRT2090183	hsa-miR-3611	CLIP-seq
MIRT2314909	hsa-miR-128	CLIP-seq
MIRT2314910	hsa-miR-4436b-5p	CLIP-seq
MIRT2314911	hsa-miR-520f	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	TAS	9748279
GO:0005515	Function	Protein binding	IPI	20859254, 21516116, 23088713, 25416956, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	10791963
GO:0005802	Component	Trans-Golgi network	IMP	10791963
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9748279
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 607193
• HGNC: 14600
• e!Ensembl: ENSG00000147509

Protein

• UniProt ID: O76081
• Protein name: Regulator of G-protein signaling 20 (RGS20) (Gz-selective GTPase-activating protein) (G(z)GAP) (Gz-GAP) (Regulator of G-protein signaling Z1) (Regulator of Gz-selective protein signaling 1)
• Protein function: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and r
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	262 → 377	Regulator of G protein signaling domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
• Sequence:

  MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPA
  QLPDSPAAPKLFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGH
  EELPGRLSLLLGAALALPGRPSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMR
  KRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRA
  DLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKK
  EANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLM
  HRDSYPRFMNSAVYKDLLQSLSEKSIEA

• Sequence length: 388

Pathways

Reactome:

G alpha (i) signalling events
G alpha (z) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31212130		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28237701		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31212130		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18360038		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36793937	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28237701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31212130		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29484420		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28237701		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31212130	Stimulate	★☆☆☆☆ Found in Text Mining only