CAV1 (caveolin 1)

Gene

• Entrez ID: 857
• Gene name: Caveolin 1
• Gene symbol: CAV1
• Synonyms (NCBI Gene): BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21
• Chromosome: 7
• Chromosome location: 7q31.2
• Summary: The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway a

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434501	G>T	Pathogenic	Coding sequence variant, stop gained
rs370105972	G>T	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant, stop gained
rs587777017	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs587780295	TT>A	Pathogenic	Coding sequence variant, frameshift variant
rs797044871	TT>-	Pathogenic	Coding sequence variant, stop gained
rs797045176	C>T	Pathogenic	Coding sequence variant, stop gained
rs879255566	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs879255578	A>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000753	hsa-miR-34b-5p	Review, Microarray	19461653
MIRT000752	hsa-miR-34c-5p	Review, Microarray	19461653
MIRT002719	hsa-miR-124-3p	Microarray	15685193
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assay, Microarray	21654750
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assay, Microarray	21654750
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assay, Microarray	21654750
MIRT002719	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002719	hsa-miR-124-3p	Microarray	15685193
MIRT025929	hsa-miR-7-5p	Microarray	19073608
MIRT030024	hsa-miR-26b-5p	Microarray	19088304
MIRT035548	hsa-miR-199a-5p	Luciferase reporter assay	23459460
MIRT035548	hsa-miR-199a-5p	Luciferase reporter assay	23459460
MIRT053182	hsa-miR-203a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22421148
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25407491
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25407491
MIRT054189	hsa-miR-107	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25407491
MIRT054189	hsa-miR-107	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25407491
MIRT054826	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR, Western blot	24623846
MIRT002719	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24000013
MIRT035548	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT035548	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT002719	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24000013
MIRT035548	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT035548	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT613253	hsa-miR-5193	HITS-CLIP	19536157
MIRT613252	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT613251	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT613254	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT704989	hsa-miR-4517	HITS-CLIP	23313552
MIRT704988	hsa-miR-338-5p	HITS-CLIP	23313552
MIRT704987	hsa-miR-1911-3p	HITS-CLIP	23313552
MIRT704986	hsa-miR-6753-5p	HITS-CLIP	23313552
MIRT704985	hsa-miR-6165	HITS-CLIP	23313552
MIRT704984	hsa-miR-208a-5p	HITS-CLIP	23313552
MIRT704983	hsa-miR-208b-5p	HITS-CLIP	23313552
MIRT704982	hsa-miR-556-5p	HITS-CLIP	23313552
MIRT704981	hsa-miR-4459	HITS-CLIP	23313552
MIRT704980	hsa-miR-4514	HITS-CLIP	23313552
MIRT704979	hsa-miR-4692	HITS-CLIP	23313552
MIRT704978	hsa-miR-4645-5p	HITS-CLIP	23313552
MIRT704977	hsa-miR-4673	HITS-CLIP	23313552
MIRT704976	hsa-miR-4468	HITS-CLIP	23313552
MIRT704975	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT704974	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT704973	hsa-miR-766-5p	HITS-CLIP	23313552
MIRT704972	hsa-miR-3201	HITS-CLIP	23313552
MIRT704971	hsa-miR-4791	HITS-CLIP	23313552
MIRT704970	hsa-miR-1261	HITS-CLIP	23313552
MIRT704969	hsa-miR-5004-3p	HITS-CLIP	23313552
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT220128	hsa-miR-3609	PAR-CLIP	20371350
MIRT220129	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT220121	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT220123	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT220117	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT220118	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT220124	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT220126	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT220125	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT220120	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT220130	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT568210	hsa-miR-4463	PAR-CLIP	20371350
MIRT319305	hsa-miR-3973	PAR-CLIP	20371350
MIRT568209	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568208	hsa-miR-520h	PAR-CLIP	20371350
MIRT568207	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT025929	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT220122	hsa-miR-194-5p	PAR-CLIP	20371350
MIRT035548	hsa-miR-199a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26163491
MIRT035548	hsa-miR-199a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	26163491
MIRT002719	hsa-miR-124-3p	Western blot	26002553
MIRT735631	hsa-miR-451a	Luciferase reporter assay, Western blotting, qRT-PCR	32013265
MIRT737115	hsa-miR-3074-3p	Luciferase reporter assay, Immunofluorescence, qRT-PCR	32438970
MIRT613253	hsa-miR-5193	HITS-CLIP	19536157
MIRT613252	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT613251	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT613254	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT704989	hsa-miR-4517	HITS-CLIP	23313552
MIRT704988	hsa-miR-338-5p	HITS-CLIP	23313552
MIRT704987	hsa-miR-1911-3p	HITS-CLIP	23313552
MIRT704986	hsa-miR-6753-5p	HITS-CLIP	23313552
MIRT704985	hsa-miR-6165	HITS-CLIP	23313552
MIRT704984	hsa-miR-208a-5p	HITS-CLIP	23313552
MIRT704983	hsa-miR-208b-5p	HITS-CLIP	23313552
MIRT704982	hsa-miR-556-5p	HITS-CLIP	23313552
MIRT704981	hsa-miR-4459	HITS-CLIP	23313552
MIRT704980	hsa-miR-4514	HITS-CLIP	23313552
MIRT704979	hsa-miR-4692	HITS-CLIP	23313552
MIRT704978	hsa-miR-4645-5p	HITS-CLIP	23313552
MIRT704977	hsa-miR-4673	HITS-CLIP	23313552
MIRT704976	hsa-miR-4468	HITS-CLIP	23313552
MIRT704975	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT704974	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT704973	hsa-miR-766-5p	HITS-CLIP	23313552
MIRT704972	hsa-miR-3201	HITS-CLIP	23313552
MIRT704971	hsa-miR-4791	HITS-CLIP	23313552
MIRT704970	hsa-miR-1261	HITS-CLIP	23313552
MIRT704969	hsa-miR-5004-3p	HITS-CLIP	23313552
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT220128	hsa-miR-3609	PAR-CLIP	20371350
MIRT220129	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT220121	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT220123	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT220117	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT220118	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT220124	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT220126	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT220125	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT220120	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT220130	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT568210	hsa-miR-4463	PAR-CLIP	20371350
MIRT319305	hsa-miR-3973	PAR-CLIP	20371350
MIRT568209	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568208	hsa-miR-520h	PAR-CLIP	20371350
MIRT568207	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT025929	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT220122	hsa-miR-194-5p	PAR-CLIP	20371350
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT864484	hsa-miR-548an	CLIP-seq
MIRT864485	hsa-miR-103a	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT864488	hsa-miR-1301	CLIP-seq
MIRT864489	hsa-miR-194	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT864496	hsa-miR-4464	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT864498	hsa-miR-4714-5p	CLIP-seq
MIRT864499	hsa-miR-4748	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT864501	hsa-miR-4803	CLIP-seq
MIRT864502	hsa-miR-5047	CLIP-seq
MIRT864503	hsa-miR-520g	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT864505	hsa-miR-1238	CLIP-seq
MIRT864506	hsa-miR-1321	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT864509	hsa-miR-3127-5p	CLIP-seq
MIRT864510	hsa-miR-3148	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT864514	hsa-miR-4270	CLIP-seq
MIRT864515	hsa-miR-4282	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT864517	hsa-miR-4441	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT864520	hsa-miR-4739	CLIP-seq
MIRT864521	hsa-miR-4756-5p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT864523	hsa-miR-485-5p	CLIP-seq
MIRT864524	hsa-miR-548ag	CLIP-seq
MIRT864525	hsa-miR-548ai	CLIP-seq
MIRT864526	hsa-miR-548c-3p	CLIP-seq
MIRT864527	hsa-miR-548m	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT864501	hsa-miR-4803	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT1556137	hsa-miR-1207-5p	CLIP-seq
MIRT1556138	hsa-miR-124	CLIP-seq
MIRT1556139	hsa-miR-1909	CLIP-seq
MIRT1556140	hsa-miR-3184	CLIP-seq
MIRT1556141	hsa-miR-423-5p	CLIP-seq
MIRT1556142	hsa-miR-4476	CLIP-seq
MIRT1556143	hsa-miR-4716-3p	CLIP-seq
MIRT1556144	hsa-miR-4723-5p	CLIP-seq
MIRT1556145	hsa-miR-4728-5p	CLIP-seq
MIRT1556146	hsa-miR-4736	CLIP-seq
MIRT1556147	hsa-miR-4763-3p	CLIP-seq
MIRT1556148	hsa-miR-506	CLIP-seq
MIRT1556149	hsa-miR-592	CLIP-seq
MIRT1556150	hsa-miR-597	CLIP-seq
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT1956250	hsa-miR-3924	CLIP-seq
MIRT1956251	hsa-miR-4672	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT1956253	hsa-miR-935	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT2427058	hsa-miR-106a	CLIP-seq
MIRT2427059	hsa-miR-106b	CLIP-seq
MIRT2427060	hsa-miR-1253	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2427062	hsa-miR-17	CLIP-seq
MIRT2427063	hsa-miR-20a	CLIP-seq
MIRT2427064	hsa-miR-20b	CLIP-seq
MIRT2427065	hsa-miR-298	CLIP-seq
MIRT2427066	hsa-miR-302a	CLIP-seq
MIRT2427067	hsa-miR-302b	CLIP-seq
MIRT2427068	hsa-miR-302c	CLIP-seq
MIRT2427069	hsa-miR-302d	CLIP-seq
MIRT2427070	hsa-miR-302e	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT2427073	hsa-miR-323b-3p	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT2427075	hsa-miR-372	CLIP-seq
MIRT2427076	hsa-miR-373	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT2427078	hsa-miR-4259	CLIP-seq
MIRT864515	hsa-miR-4282	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2427082	hsa-miR-4684-3p	CLIP-seq
MIRT2427083	hsa-miR-4699-5p	CLIP-seq
MIRT2427084	hsa-miR-4715-5p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2427087	hsa-miR-513a-3p	CLIP-seq
MIRT2427088	hsa-miR-519d	CLIP-seq
MIRT2427089	hsa-miR-520a-3p	CLIP-seq
MIRT2427090	hsa-miR-520b	CLIP-seq
MIRT2427091	hsa-miR-520c-3p	CLIP-seq
MIRT2427092	hsa-miR-520d-3p	CLIP-seq
MIRT2427093	hsa-miR-520e	CLIP-seq
MIRT2427094	hsa-miR-520f	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT864526	hsa-miR-548c-3p	CLIP-seq
MIRT2427096	hsa-miR-595	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT2427098	hsa-miR-7	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT2427100	hsa-miR-93	CLIP-seq
MIRT2497104	hsa-miR-1202	CLIP-seq
MIRT2497105	hsa-miR-1207-3p	CLIP-seq
MIRT2497106	hsa-miR-1245	CLIP-seq
MIRT2497107	hsa-miR-1246	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2497108	hsa-miR-1292	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT2497109	hsa-miR-136	CLIP-seq
MIRT2497110	hsa-miR-1587	CLIP-seq
MIRT2497111	hsa-miR-1913	CLIP-seq
MIRT2497112	hsa-miR-200b	CLIP-seq
MIRT2497113	hsa-miR-200c	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT2497114	hsa-miR-3134	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT2497115	hsa-miR-3194-5p	CLIP-seq
MIRT2497116	hsa-miR-324-3p	CLIP-seq
MIRT2497117	hsa-miR-34a	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT2497118	hsa-miR-3647-3p	CLIP-seq
MIRT2497119	hsa-miR-3670	CLIP-seq
MIRT2497120	hsa-miR-369-3p	CLIP-seq
MIRT2497121	hsa-miR-377	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT2497122	hsa-miR-3972	CLIP-seq
MIRT2497123	hsa-miR-409-3p	CLIP-seq
MIRT2497124	hsa-miR-4251	CLIP-seq
MIRT2497125	hsa-miR-429	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT2497126	hsa-miR-4320	CLIP-seq
MIRT2497127	hsa-miR-4436b-5p	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT2497128	hsa-miR-4471	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2497129	hsa-miR-449a	CLIP-seq
MIRT2497130	hsa-miR-449b	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT2497131	hsa-miR-4534	CLIP-seq
MIRT2497132	hsa-miR-4637	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2497133	hsa-miR-4674	CLIP-seq
MIRT2497134	hsa-miR-4690-3p	CLIP-seq
MIRT2497135	hsa-miR-4749-3p	CLIP-seq
MIRT2497136	hsa-miR-4757-5p	CLIP-seq
MIRT2497137	hsa-miR-4760-3p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2497138	hsa-miR-4783-3p	CLIP-seq
MIRT2497139	hsa-miR-539	CLIP-seq
MIRT2497140	hsa-miR-548a-3p	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT2497141	hsa-miR-548e	CLIP-seq
MIRT2497142	hsa-miR-548f	CLIP-seq
MIRT2497143	hsa-miR-570	CLIP-seq
MIRT2497144	hsa-miR-579	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT2497145	hsa-miR-664	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT2497104	hsa-miR-1202	CLIP-seq
MIRT2497105	hsa-miR-1207-3p	CLIP-seq
MIRT2497106	hsa-miR-1245	CLIP-seq
MIRT2497107	hsa-miR-1246	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2497108	hsa-miR-1292	CLIP-seq
MIRT2677434	hsa-miR-1305	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT2497109	hsa-miR-136	CLIP-seq
MIRT2497110	hsa-miR-1587	CLIP-seq
MIRT2497111	hsa-miR-1913	CLIP-seq
MIRT2497112	hsa-miR-200b	CLIP-seq
MIRT2497113	hsa-miR-200c	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT2497114	hsa-miR-3134	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT2497115	hsa-miR-3194-5p	CLIP-seq
MIRT2497116	hsa-miR-324-3p	CLIP-seq
MIRT2497117	hsa-miR-34a	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT2497118	hsa-miR-3647-3p	CLIP-seq
MIRT2497119	hsa-miR-3670	CLIP-seq
MIRT2497120	hsa-miR-369-3p	CLIP-seq
MIRT2497121	hsa-miR-377	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT2497122	hsa-miR-3972	CLIP-seq
MIRT2497123	hsa-miR-409-3p	CLIP-seq
MIRT2497124	hsa-miR-4251	CLIP-seq
MIRT2497125	hsa-miR-429	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT2497126	hsa-miR-4320	CLIP-seq
MIRT2497127	hsa-miR-4436b-5p	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT2497128	hsa-miR-4471	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2497129	hsa-miR-449a	CLIP-seq
MIRT2497130	hsa-miR-449b	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT2497131	hsa-miR-4534	CLIP-seq
MIRT2497132	hsa-miR-4637	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2497133	hsa-miR-4674	CLIP-seq
MIRT2497134	hsa-miR-4690-3p	CLIP-seq
MIRT2677435	hsa-miR-4718	CLIP-seq
MIRT2677436	hsa-miR-4742-3p	CLIP-seq
MIRT2497135	hsa-miR-4749-3p	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT2497136	hsa-miR-4757-5p	CLIP-seq
MIRT2497137	hsa-miR-4760-3p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT2677437	hsa-miR-4766-3p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2497138	hsa-miR-4783-3p	CLIP-seq
MIRT2497139	hsa-miR-539	CLIP-seq
MIRT2497140	hsa-miR-548a-3p	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT2497141	hsa-miR-548e	CLIP-seq
MIRT2497142	hsa-miR-548f	CLIP-seq
MIRT2497143	hsa-miR-570	CLIP-seq
MIRT2497144	hsa-miR-579	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT2497145	hsa-miR-664	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT2677438	hsa-miR-890	CLIP-seq
MIRT2677439	hsa-miR-891b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA6	Repression	21514437
PPARG	Unknown	17764562
SP1	Unknown	10684646
SREBF1	Repression	19808659
TFDP1	Unknown	10684646
TP53	Activation	10684646

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000139	Component	Golgi membrane	IDA	11294831
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IBA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	ISS
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002067	Process	Glandular epithelial cell differentiation	IEA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0002095	Component	Caveolar macromolecular signaling complex	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003057	Process	Regulation of the force of heart contraction by chemical signal	IEA
GO:0005102	Function	Signaling receptor binding	IPI	16890161
GO:0005113	Function	Patched binding	NAS	11278759
GO:0005515	Function	Protein binding	IPI	10212252, 11075810, 11294831, 12176037, 15182174, 15504032, 15657067, 15657086, 15703204, 16388599, 16799092, 16890161, 16951145, 17287217, 17848177, 17855368, 18923542, 19052258, 19262564, 19706440, 19726876, 19820694, 19897728, 19931615, 20808760, 20826780, 20956295, 21382479, 218
GO:0005768	Component	Endosome	IDA	20682791
GO:0005783	Component	Endoplasmic reticulum	IDA	11294831
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	24089527
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005811	Component	Lipid droplet	TAS
GO:0005886	Component	Plasma membrane	IDA	23262137
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	15219854, 15703204, 17982011, 18081315, 19525939, 24013648, 25556234
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	NAS	15657086
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	12091389
GO:0005925	Component	Focal adhesion	IEA
GO:0005929	Component	Cilium	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0006940	Process	Regulation of smooth muscle contraction	ISS
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007519	Process	Skeletal muscle tissue development	ISS
GO:0007595	Process	Lactation	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008104	Process	Intracellular protein localization	ISS
GO:0008142	Function	Oxysterol binding	IEA
GO:0008142	Function	Oxysterol binding	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009267	Process	Cellular response to starvation	IEP	15657086
GO:0009617	Process	Response to bacterium	IDA	24625804
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	ISS	19052258
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	24576892
GO:0015031	Process	Protein transport	IEA
GO:0015485	Function	Cholesterol binding	TAS	11294831
GO:0016020	Component	Membrane	IDA	24625804
GO:0016020	Component	Membrane	IEA
GO:0016050	Process	Vesicle organization	ISS
GO:0016323	Component	Basolateral plasma membrane	IDA	16904002
GO:0016324	Component	Apical plasma membrane	IDA	16904002
GO:0016504	Function	Peptidase activator activity	IEA
GO:0016504	Function	Peptidase activator activity	ISS
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	IGI	21047970
GO:0019217	Process	Regulation of fatty acid metabolic process	IEA
GO:0019217	Process	Regulation of fatty acid metabolic process	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019899	Function	Enzyme binding	IPI	20122998
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	25006397
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	ISS
GO:0030154	Process	Cell differentiation	IBA
GO:0030193	Process	Regulation of blood coagulation	IMP	17848177
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IEA
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IMP	25006397
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	ISS
GO:0030301	Process	Cholesterol transport	TAS	11294831
GO:0030335	Process	Positive regulation of cell migration	IMP	21109942
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	15657086
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	ISS
GO:0030879	Process	Mammary gland development	IEA
GO:0030879	Process	Mammary gland development	ISS
GO:0031267	Function	Small GTPase binding	IPI	24625804
GO:0031295	Process	T cell costimulation	IDA	17287217
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	22277751
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	24089527
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	19931615, 22792322
GO:0031623	Process	Receptor internalization	IDA	25893292
GO:0031623	Process	Receptor internalization	IMP	16890161
GO:0031901	Component	Early endosome membrane	TAS
GO:0032507	Process	Maintenance of protein location in cell	ISS
GO:0032570	Process	Response to progesterone	IDA	12388746
GO:0032991	Component	Protein-containing complex	IDA	21822278, 24013648
GO:0032991	Component	Protein-containing complex	IEA
GO:0033484	Process	Intracellular nitric oxide homeostasis	IEA
GO:0033484	Process	Intracellular nitric oxide homeostasis	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	15618008, 16751103
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0036487	Function	Nitric-oxide synthase inhibitor activity	EXP	9325253, 9712842
GO:0038016	Process	Insulin receptor internalization	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	ISS
GO:0042310	Process	Vasoconstriction	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042632	Process	Cholesterol homeostasis	TAS	11294831
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25006397
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	23319823
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0043627	Process	Response to estrogen	IDA	12388746
GO:0043627	Process	Response to estrogen	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	18923542
GO:0044860	Process	Protein localization to plasma membrane raft	ISS
GO:0044877	Function	Protein-containing complex binding	IPI	24089527
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045121	Component	Membrane raft	IDA	11294831, 14559243, 17010968, 21382479, 23262137, 24576892, 25204797, 25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19931615
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048550	Process	Negative regulation of pinocytosis	IMP	23583380
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0050998	Function	Nitric-oxide synthase binding	IPI	12852865
GO:0051117	Function	ATPase binding	IPI	24089527
GO:0051117	Function	ATPase binding	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	19052258
GO:0051592	Process	Response to calcium ion	IEA
GO:0051592	Process	Response to calcium ion	ISS	19052258
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051899	Process	Membrane depolarization	IEA
GO:0051899	Process	Membrane depolarization	ISS
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0055074	Process	Calcium ion homeostasis	ISS
GO:0060056	Process	Mammary gland involution	IEA
GO:0060056	Process	Mammary gland involution	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	16890161
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060090	Function	Molecular adaptor activity	TAS	19052258
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0070320	Function	Inward rectifier potassium channel inhibitor activity	IDA	18923542
GO:0070836	Process	Caveola assembly	IBA
GO:0070836	Process	Caveola assembly	IEA
GO:0070836	Process	Caveola assembly	IEA
GO:0070836	Process	Caveola assembly	IGI	25006397
GO:0070836	Process	Caveola assembly	IMP	12633858
GO:0070836	Process	Caveola assembly	ISS
GO:0071218	Process	Cellular response to misfolded protein	IMP	24089527
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071455	Process	Cellular response to hyperoxia	IMP	21382479
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071711	Process	Basement membrane organization	IEA
GO:0072584	Process	Caveolin-mediated endocytosis	IDA	19931615
GO:0072584	Process	Caveolin-mediated endocytosis	IEA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IEA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0097190	Process	Apoptotic signaling pathway	IMP	21382479
GO:0098903	Process	Regulation of membrane repolarization during action potential	IMP	18923542
GO:0098909	Process	Regulation of cardiac muscle cell action potential involved in regulation of contraction	IMP	18923542
GO:0098911	Process	Regulation of ventricular cardiac muscle cell action potential	IEA
GO:0098911	Process	Regulation of ventricular cardiac muscle cell action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15734843
GO:0140311	Function	Protein sequestering activity	ISS	19265160
GO:1900027	Process	Regulation of ruffle assembly	IDA	24625804
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IMP	18923542
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	IEA
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	ISS
GO:1903361	Process	Protein localization to basolateral plasma membrane	ISS
GO:1903598	Process	Positive regulation of gap junction assembly	IEA
GO:1903598	Process	Positive regulation of gap junction assembly	ISS
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	24089527
GO:2000535	Process	Regulation of entry of bacterium into host cell	IDA	24625804
GO:2000811	Process	Negative regulation of anoikis	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	22277751
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21382479
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21382479

Other IDs

• MIM: 601047
• HGNC: 1527
• e!Ensembl: ENSG00000105974

Protein

• UniProt ID: Q03135
• Protein name: Caveolin-1
• Protein function: May act as a scaffolding protein within caveolar membranes (PubMed:11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4)
• PDB: 7SC0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01146	Caveolin	42 → 175	Caveolin	Family

• Tissue specificity: TISSUE SPECIFICITY: Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain. {ECO:0000269|PubMed:19262564}.
• Sequence:

  MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
  DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
  ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

• Sequence length: 178

Pathways

KEGG:

Endocytosis
Focal adhesion
Prion disease
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Viral myocarditis
Fluid shear stress and atherosclerosis

Reactome:

eNOS activation
NOSTRIN mediated eNOS trafficking
Basigin interactions
Disassembly of the destruction complex and recruitment of AXIN to the membrane
VEGFR2 mediated vascular permeability
Extra-nuclear estrogen signaling
FOXO-mediated transcription of cell cycle genes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
CAV1-related disorder	Likely pathogenic	rs2485219428	RCV003404452	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital generalized lipodystrophy type 3	Pathogenic	rs797044871, rs797045176, rs121434501, rs2485218609	RCV000191044 RCV000191043 RCV000008988 RCV003152354	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Partial lipodystrophy, congenital cataracts, and neurodegeneration syndrome	Pathogenic; Likely pathogenic	rs2116116365, rs879255578, rs797044871, rs797045176, rs121434501, rs2485219617	RCV002249329 RCV000186515 RCV000766129 RCV000766128 RCV002247278 RCV003990092	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pulmonary hypertension, primary, 3	Pathogenic; Likely pathogenic	rs587780295, rs2116117201, rs797044871, rs587777017, rs879255566	RCV000116581 RCV001984115 RCV000191044 RCV000050248 RCV000050249	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Amyotrophic lateral sclerosis	Conflicting classifications of pathogenicity	ClinVar ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERARDINELLI-SEIP CONGENITAL LIPODYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOGENESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE CUTANEOUS SYSTEMIC SCLEROSIS	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL GENERALIZED LIPODYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY KOBBERLING TYPE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PARTIAL LIPODYSTROPHY, TYPE 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PRIMARY PULMONARY HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HERITABLE PULMONARY ARTERIAL HYPERTENSION	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY HYPERTENSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIMITED CUTANEOUS SYSTEMIC SCLEROSIS	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY, CONGENITAL GENERALIZED, TYPE 3	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY, FAMILIAL PARTIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY, FAMILIAL PARTIAL, TYPE 7	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPODYSTROPHY, NOT ELSEWHERE CLASSIFIED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAROXYSMAL TACHYCARDIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension associated with congenital heart disease	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Radioulnar synostosis with amegakaryocytic thrombocytopenia 2	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, LIMITED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLEROSIS WITH LIMITED CUTANEOUS INVOLVEMENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acanthosis Nigricans	Acanthosis Nigricans	HPO_DG			★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	BEFREE	30233709		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	31769542		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20881564, 23354516		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12414512, 15069532, 17786288, 18444242, 18802406		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15069532, 15331180, 19614763, 21165568, 27771795, 28243118, 29850392, 31512057		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15069532, 18444242		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28243118		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22200856, 22406084, 23677397, 26094077, 27771795, 28099944, 28229621, 29137977, 30604627		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15969750		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12970324		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18444242, 23640045		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	20061557		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31284269		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	23185447, 25313138		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33773368	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31527120		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	24782297	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	33037799	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31527120		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29849903, 30894019		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Anaplasia	Anaplasia	BEFREE	15331180		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19716156		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	12782592, 22513979		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	22422066, 29852412		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	32141441	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19665245, 28687352		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32633891	Associate	★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	BEFREE	31256294		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29549671	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29549671		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	24375805		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	30233709		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15950204, 18596970, 20375905, 20406324, 20581059, 21074769, 24161393, 26433014, 26775120, 28130355, 29488619, 29746866, 30685852, 30729525, 31154825		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30079994	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23742006		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34456632	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11857686, 19287309, 19716156, 27129210, 31635212		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27129210	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	20099006		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11529503, 20187291, 21074769, 26775120	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15950204, 18596970, 20375905, 20406324, 20581059, 21074769, 24161393, 26775120, 28130355, 29488619, 29746866, 30685852, 30729525, 31154825		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	20062060, 22544366, 29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	20062060, 24239840, 25120818, 25953654, 26267381, 29545482, 29915175, 31152482, 33350184, 37824462, 39331874	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20062063, 22336519, 24454806, 25120818, 25196315, 25391453, 25953654, 26073630, 26267381, 27775682, 28129963, 31626676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	22544366, 28416818, 28416822, 29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASDB_DG	22544366		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	24454806	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrioventricular Block	Atrioventricular block	BEFREE	20062063		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28805811, 30543678		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	22474125, 24885118		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24885118	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21514437		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	15968725		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24581832		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14506991, 21789897, 22353809, 24968949, 28342660, 30214503, 31289491		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	15050898		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	36357389	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17460461, 27653874, 30993541		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	18778685		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	16541313		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10218480, 11289096, 11773442, 11948420, 12368209, 14506991, 15305200, 15334058, 15375584, 15647832, 15692148, 16505105, 16541313, 16723714, 16778082, 17014845, 17108100, 17229776, 18296864, 18598695, 19234134, 19244345, 19288272, 19342880, 19395651, 19411449, 19483462, 20442453, 20562526, 20581046, 20861672, 21039037, 21133631, 21150282, 21585620, 21622714, 21901387, 21909981, 21965771, 22129993, 22353223, 22411315, 22488553, 22502704, 22684333, 23114650, 23128390, 23338761, 23397229, 23469926, 24590865, 24604116, 25085904, 25192721, 25397596, 25977173, 26543228, 26902604, 27213551, 27773611, 28236153, 28243118, 28364168, 28857238, 29207674, 29212030, 29525429, 29805656, 30146689, 30220978, 30250548, 30333750, 30338706, 30673589, 30784915, 30808745, 30881011, 31303379, 31485620		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19234134, 19288272, 20562527, 21501481		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15305200, 15498565, 16979166, 18032821, 18296864, 18612310, 18836420, 19234134, 19244345, 19342880, 19448435, 19465642, 19483462, 20103682, 20581046, 21039037, 21133631, 21521946, 21585620, 22057638, 22433870, 22502704, 23128390, 23139263, 23172369, 23203033, 23875900, 23907124, 23936147, 25192721, 25397596, 25579546, 26172389, 26647977, 27213551, 27773611, 28236153, 29331414, 29500444, 30348118, 30808745, 31113938, 32736587, 32825330, 33380715, 33531603, 33833286, 34009483, 34979904, 36233075, 36604141, 37017811, 37432976, 37773865, 37822942, 39232183	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19234134, 19411448, 20431349, 20562526, 20814239	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	28555112		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	22474125		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12000726, 12598331, 15274335, 18032821, 19239691, 19434519, 19483189, 19609943, 20558341, 20562526, 21039037, 21133631, 23280667, 24885118, 25117072, 25337248, 25397596, 26066055, 29141593, 31676993, 33037799, 37233885	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	18444242	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	11857686, 12631721, 16328005, 16541313, 17487380, 19614763, 22287735, 24885118		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11953823	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18612310	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	21584795	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23907124	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19239691, 19434519, 22894556, 25117072, 25148256, 25243186, 26138883, 27588480, 29022911, 29049173, 29270591, 35255206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20562526, 23907124	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	18836420	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	17342767	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11245599, 21789897, 22353809, 24968949, 28342660, 30214503, 31289491		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	27289429		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10049753, 15331180, 19483189, 19614763, 20127174, 21165568, 22287735, 22406084, 22564243, 22898083, 24939878, 24967418, 25015569, 25222296, 26315660, 26876307, 27430913, 28099944, 29080835, 29190968, 29221162, 29247004, 29850392, 30901662, 30986357, 31270811		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32401768	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32243098, 37653101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34590611	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	14612902, 17594718, 18283322, 22152020, 24119769, 26002553, 26043775, 26066055, 28004769, 31850854, 32990143	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20558341, 34647699	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	18437015	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	19614763		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11032026, 11696424, 11863219, 26503358, 30487062, 31228941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17584106, 18022214, 24835767, 28130355, 29112590		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24454806, 36324080, 38268038, 40332409	Associate	★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	16034451		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	18237401, 25898808, 37131205	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, COPPOCK-LIKE	Cataract	BEFREE	29891777		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28300551, 29299743, 29665111, 31673241		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28346478	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27462098, 28346478, 29412114, 30354902, 31603990		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12888893		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12888893		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29575396		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	20463894		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	22474125		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	31236330		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21976276		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26433014		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	30806156		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22571278, 24842472, 28971726		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22829758, 27613621		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24943192		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14564631, 17570224, 26086560, 29067114, 31239768		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Classical Lissencephaly	Lissencephaly	BEFREE	29338612		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29968232		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36357389	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31584460	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11059785, 15069532, 15274335, 15342379, 16202996, 18283336, 19244345, 22674854, 22874559, 23280667, 26794448, 29403054		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	17606426	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11059785, 26251082		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11114180, 23280667, 9829965	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15069532, 16601146, 18258603		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15274335, 16820915, 22706202, 23640045, 26251082, 26259513, 28346422, 28560511, 29339715		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15274335, 16202996, 16820915		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15274335	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16820915, 18176934, 18283336, 18444242, 19244345, 22874559, 23280667, 23580180, 25632186, 29339715, 30098223, 37122535, 37691929	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22874559		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	29216632		★☆☆☆☆ Found in Text Mining only
Congenital generalized lipodystrophy	Congenital Lipodystrophy	Orphanet			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14612902, 25246063, 26002553, 26043775, 26066055, 28684115		★☆☆☆☆ Found in Text Mining only
Cor pulmonale	Cor pulmonale	BEFREE	29296972		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	28727754	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26775120		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26775120, 28727754		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26775120, 28727754	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32341235	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	30233709		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26775120, 29480151		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24943192		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	ORPHANET_DG	22402147		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37550393	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	21467199		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23606537		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31391685		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30505270		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	36357389	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31493519		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14962949, 26475177, 28489581, 29736213		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28125642, 31448673	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14962949, 26475177, 28489581, 29412792, 29736213		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26066055, 32125224, 33964050, 35592524, 36497195, 36837510	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17803693	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29563255, 37582184, 39528503	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30543678		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17803693, 28130355, 28923309, 29563255, 31527120, 31583475, 31728004		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25196431, 28283950, 31217420, 31492508		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	30830585		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	27981790	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	31318049		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36506045, 38084838	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	22513979		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	19716156		★☆☆☆☆ Found in Text Mining only
Diffuse cutaneous systemic sclerosis	Diffuse Cutaneous Systemic Sclerosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Scleroderma	Scleroderma	ORPHANET_DG	22402147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	16324201		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	37894778	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19134193, 27124120, 27680666, 29746866		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	34001235, 34544501	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	31583475		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	30771426		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	30670717		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26054531		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	26054531		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26054531, 37233761	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	24146786		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	21059755		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32501993	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	12812318		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	29524224		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11920460, 17671707		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17671707		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24885118	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11920460, 24885118, 26768616, 29288243	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17047056, 19609943, 21106507, 23951165, 27894957		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	18211975, 18698612, 19162222, 24152769, 25898808, 27717241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial generalized lipodystrophy	Lipodystrophy	LHGDN	18211975		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial generalized lipodystrophy	Lipodystrophy	ORPHANET_DG	18211975		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial generalized lipodystrophy	Lipodystrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	19162222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial partial lipodystrophy	Partial Lipodystrophy	CTD_human_DG	19793595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Partial Lipodystrophy, Type 1	Partial Lipodystrophy	CTD_human_DG	19793595		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	CTD_human_DG	19793595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Partial Lipodystrophy, Type 3	Partial Lipodystrophy	CTD_human_DG	19793595		★☆☆☆☆ Found in Text Mining only
Familial primary pulmonary hypertension	Pulmonary Hypertension	ORPHANET_DG	22474227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	26539466	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial primary pulmonary hypertension	Pulmonary Hypertension	BEFREE	27884767, 28298490, 28468941, 28661905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial primary pulmonary hypertension	Pulmonary Hypertension	GENOMICS_ENGLAND_DG	29650961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial primary pulmonary hypertension	Pulmonary Hypertension	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pulmonary arterial hypertension	Pulmonary arterial hypertension	ORPHANET_DG	22474227		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	23845778		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	23845778		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28570612		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	32414752	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32414752	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	24909339, 26416628		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	11238032		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11238032		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29549726, 29891777, 30384491		★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	28445960	Inhibit	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12782592		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	23527097, 25798057	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	23592983, 25798057		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	22395498	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	27986126		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	22128235, 26015768, 27841369, 28878269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	23743525, 25103269, 25525164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	37131205	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20835238, 21321670, 21873608, 22128235, 23743525, 24518671, 24572674, 24603425, 25414181, 25489222, 25525164, 25637523, 26015768, 27297022, 29104244, 33726755	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	CTD_human_DG	20835238		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20835238, 21321670, 21873608, 22128235, 22876122, 23743525, 24034151, 24572674, 25489222, 26383992, 27297022, 29111846, 30916825		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	CTD_human_DG	20835238		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11857686, 15273741, 17460461, 18992284, 19287309, 19716156, 21882259, 23067370, 23598719, 24130882, 26898538, 28760776, 30854062, 30949900		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18992284, 24747515, 30497369, 32055849, 32065471, 34716958, 37651725	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11857686, 15273741, 17460461, 18992284, 19716156, 21882259, 23067370, 23598719, 24130882, 26898538, 28760776, 30854062, 30949900		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11857686, 17351980, 18992284, 26845757		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18992284, 34287575, 37270527	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	32349771	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	25786689		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	12782592		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29877208, 31789139		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	29877208	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32159364	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	11238032	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26566034, 30993541		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	26566034	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	29131098		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	23117935	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	37181035	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	18543249, 20583256		★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	25159282, 28967497		★☆☆☆☆ Found in Text Mining only
Heritable pulmonary arterial hypertension	Heritable Pulmonary Arterial Hypertension	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung Disease	BEFREE	31256294		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24021477		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27124120, 28346478		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	28346478	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28489581, 29331414		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	12660144, 29410348		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	17342262	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	22474125, 28554768		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type V	Hyperlipoproteinemia	Pubtator	18237401	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	27925619	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16489673, 26066055, 29662258	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25898808, 26176221, 26820968	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16601841, 20382348, 21613355, 24163076, 27771236, 27895190, 28298490, 28468941, 29410348, 30778103, 30806156, 30840346, 30943774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	1798635		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	18237401, 29662258, 29762069	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	15240128, 17471232, 18836288, 20709728, 28303387		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18717816, 22411794, 25633184, 30237409	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21521946, 31900313, 33928148	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	17470567, 20382348, 22215724, 22474227, 23883380, 24442418, 24951767, 25159282, 27470556, 27717241, 27771236, 28298490, 28468941, 28768485, 28904206, 28967497, 29069575, 29286128, 29480151, 30262154, 30943774		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	GENOMICS_ENGLAND_DG	29650961		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17178917, 18949888, 20395445, 23580232, 25394239, 27560128, 27937011, 28835128, 29567077, 31629729		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23580232	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17470567, 20382348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28587148, 29132227, 30483772, 30771426		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28489581, 30661230		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	16104000		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37550393	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	16244790, 22093547, 25559359, 27241022		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18211975, 18237401, 26475177, 29662258, 34001235	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	18681962	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29039595		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	18681962	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16324201, 26543228		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28346478, 29712879, 30572925, 31673241		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	21976276		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21976276		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17594718	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	10049753		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	17906498		★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	27773611		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28537760		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	17952758	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	11238032	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24842472, 25786689		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15234575		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15234575		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	20061557		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	23114650		★☆☆☆☆ Found in Text Mining only
Limited cutaneous systemic sclerosis	Limited Systemic Sclerosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	14719121, 21246406		★☆☆☆☆ Found in Text Mining only
Lipoatrophic Diabetes Mellitus	Lipoatrophic Diabetes Mellitus	ORPHANET_DG	18211975		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	18237401, 21392585, 25898808, 26176221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy	Lipodystrophy	LHGDN	18237401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy	Lipodystrophy	Pubtator	18237401, 25898808, 26176221, 32493699, 40332409	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy	Lipodystrophy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	18211975, 18698612, 20684003, 27717241, 32349771	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized Type 3	Lipodystrophy	Pubtator	26176221	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	22989829, 26176221	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy, Congenital Generalized, Type 3	Lipodystrophy	GENOMICS_ENGLAND_DG	18211975, 23049990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy, Congenital Generalized, Type 3	Lipodystrophy	CLINVAR_DG	25898808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy, Congenital Generalized, Type 3	Lipodystrophy	BEFREE	26176221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipodystrophy, Congenital Generalized, Type 3	Lipodystrophy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipoma	Lipoma	Pubtator	11238032	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11238032	Inhibit	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	11238032	Inhibit	★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	11238032		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16443388, 17341888, 18992712, 22072235, 22894556, 23393366, 23613870, 24222128, 25117072, 25148256, 26138883, 28083769, 29022911, 29049173, 29067114, 29221140, 29896915, 30144070, 30583072, 30745168, 30858354, 31209283, 31239768, 31358729, 31529314, 31676327		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17341888		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14564631, 17570224, 26086560, 26847875, 29067114, 30446170, 31239768, 31257611		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	23117935	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	15968725	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	17570224		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35971753	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16443388, 24222128, 26138883		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	18923542		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23743525		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30686114		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	24578173	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28932540, 31629729		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15514565, 16334154, 20923773, 24967418, 26315660, 26464635, 26876307, 31322542, 33902331, 35092415	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	19483189, 29247004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	29247004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11920460, 34616011	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19411448, 20814239, 24949874, 29850392	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29288243		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29288243, 29339715	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	16334154	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12716467	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31284269, 35138344	Associate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28555112		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10218480, 11289096, 11773442, 11948420, 12368209, 12631721, 14506991, 15305200, 15334058, 15375584, 15647832, 15692148, 16505105, 16541313, 16723714, 17014845, 17108100, 17229776, 18296864, 18598695, 19234134, 19244345, 19288272, 19342371, 19342880, 19395651, 19411449, 19483462, 19923890, 20442453, 20562526, 20581046, 20855962, 20861672, 21039037, 21133631, 21150282, 21521946, 21585620, 21622714, 21901387, 21909981, 21965771, 22129993, 22353223, 22411315, 22488553, 22502704, 22684333, 22874531, 23114650, 23128390, 23172369, 23338761, 23397229, 23469926, 24590865, 24604116, 25085904, 25192721, 25397596, 25977173, 26543228, 26902604, 27213551, 27773611, 28236153, 28243118, 28364168, 28857238, 29207674, 29212030, 29525429, 29805656, 30146689, 30220978, 30250548, 30333750, 30338706, 30673589, 30784915, 30808745, 30881011, 31303379, 31485620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19234134, 19288272, 20562527, 21501481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26054531		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17671707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21473727, 25273173, 28684115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22693251, 28083769, 29403054		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10049753, 15205342, 15331180, 19483189, 21165568, 22406084, 22564243, 22898083, 24939878, 24967418, 25015569, 25222296, 26315660, 26876307, 27430913, 28099944, 29080835, 29190968, 29221162, 29247004, 29850392, 30901662, 31270811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	29247004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	14719121, 21246406		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11032026, 11696424, 11863219, 26503358, 30487062, 31228941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	15674352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17471232, 19665245, 22041584, 22194465, 23019415, 24949874, 26065715, 30483772, 30805811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10918582, 11170154, 11389065, 11751529, 14645548, 15692148, 15948133, 16077921, 16707439, 16886623, 17943731, 18245473, 18635524, 18635971, 19186008, 19581923, 19903767, 19923922, 20209490, 20466611, 20732728, 21378366, 22075971, 22144662, 23203033, 23352616, 23482776, 23645736, 23729330, 23934233, 24222128, 24375805, 25942420, 27764093, 28697756, 28710901, 29402961, 30424755, 31081050, 31685812, 9734401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15948133, 22159333		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31845391		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17875691, 22370641, 23203033, 23592983, 24065198, 24070739, 24778029, 25339030, 25798057, 26817615, 28365694, 28828003, 29089565, 29141593		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22513979, 26633361		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25633184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21789897, 22353809, 24968949, 28342660, 30214503, 31289491		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10049753, 11170154, 12782592, 15052333, 15969750, 16707439, 16820915, 17699771, 18406871, 18598695, 18635524, 18992284, 19521982, 19903767, 20153318, 20442453, 20562526, 20581046, 20709760, 20814239, 20855962, 21133631, 21150282, 21471610, 21585620, 21670602, 21882259, 21913217, 22194465, 22201996, 22396494, 22411315, 22593443, 22706202, 22874559, 23114650, 23172369, 23228128, 23397229, 23404184, 23598720, 23603343, 23645736, 23845778, 23860382, 24222128, 24427291, 24467203, 24738074, 24842472, 24949874, 25015569, 25085904, 25192721, 25579546, 25633184, 25822667, 26054531, 26066055, 26364240, 26543228, 26566034, 26794448, 26817615, 26843476, 27764093, 27771795, 27818286, 27852311, 27986126, 28243118, 28342660, 28364168, 28386695, 28440485, 28515480, 28546853, 28560511, 28592633, 28593998, 28828003, 28923854, 28978009, 29137396, 29247004, 29288243, 29340103, 29434845, 29524224, 29847075, 29986880, 30088837, 30146689, 30246033, 30338706, 30463805, 30483772, 30805811, 30825645, 30993541, 31362353, 31635212, 31803361, 9525738		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	17906498		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12888893		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11059785, 15069532, 15274335, 15342379, 16202996, 18283336, 19244345, 22674854, 22874559, 23280667, 26251082, 26794448, 29403054		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19234134, 19288272, 20562527, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10086342, 14506991, 15334058, 18778685, 23128390, 28187162		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15334058, 15375584, 15592498, 16244790, 16541313, 16897435, 17190831, 17935714, 18296864, 19234134		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19234134, 19288272, 20562527, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19234134, 19288272, 20562527, 21501481		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	29174139	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17284246, 19521982, 19801663, 21373757, 22201996, 27053106, 36519961	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19521982, 20709760, 21445970, 22201996, 22396494, 24659799, 27053106, 29972676, 31484460		★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	23560644		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	16850311		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	16850311, 18282163		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31512057	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30622557		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	34001235, 34544501	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26475177, 29662258, 29762069, 34384444, 36497195, 38268038, 39528503	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16601841, 26475177, 29762069, 30622557, 30949197		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18245473, 20209490, 20732728, 23729330, 25942420		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20814239, 21521946	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	BEFREE	19287309, 19716156		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	14719121		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	27462098, 29718794, 30355208		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	27462098, 29718794, 30355208		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	32341235	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15492276		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19828204, 21683457, 22067141		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenic Syndromes, Congenital	Myasthenic Syndrome	BEFREE	18836288		★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23659685, 26239609, 27717241		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18596970, 26775120		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26775120	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	29500444	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29500444		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24943192, 30297114		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19582878, 21965789, 25877996		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	15968725, 38065913	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	30899070		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30899070		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10049753, 10086342, 11059785, 11076533, 11170154, 11238032, 11498016, 11696424, 11857686, 11863219, 11918088, 11920460, 12185081, 12368209, 12415733, 12620387, 12631721, 12782592, 12888893, 14506991, 14612902, 14719121, 14981899, 15036650, 15095482, 15205342, 15273741, 15274335, 15305200, 15331180, 15334058, 15342379, 15674352, 15692148, 15969750, 16005053, 16034451, 16251425, 16324201, 16505105, 16541313, 16850311, 17047056, 17108100, 17229776, 17351980, 17359972, 17460461, 17875691, 17906498, 17943731, 18245473, 18296864, 18343216, 18406871, 18444242, 18458534, 18778685, 18802406, 19244345, 19287309, 19288272, 19411449, 19483462, 19521982, 19614763, 19665245, 19716156, 20406988, 20442453, 20466611, 20596943, 20709760, 20814239, 20820979, 20855962, 20861672, 20881564, 21059755, 21106507, 21150282, 21165568, 21246406, 21297447, 21471610, 21473727, 21521946, 21545202, 21585620, 21622714, 21670602, 21789897, 21901387, 21909981, 21913217, 21949119, 21965771, 21965789, 22041584, 22072235, 22075971, 22128235, 22213373, 22236875, 22370641, 22406084, 22411315, 22502704, 22513979, 22564243, 22674854, 22684333, 22693251, 22706202, 22898083, 23128390, 23159584, 23203033, 23228128, 23397229, 23598719, 23634843, 23640045, 23729330, 23845778, 23860382, 23951165, 24065198, 24130882, 24255086, 24427291, 24467203, 24590865, 24604116, 24738074, 24939878, 24943192, 24949874, 24968949, 25015569, 25192721, 25246063, 25313138, 25339030, 25633184, 25977173, 26054531, 26065715, 26094077, 26138391, 26251082, 26315660, 26503358, 26566034, 26768616, 26794448, 27048356, 27053106, 27168348, 27653874, 27764093, 27818286, 27847199, 27852311, 27894957, 27986126, 28112237, 28229621, 28236153, 28243118, 28342660, 28440485, 28560511, 28687352, 28710901, 28735300, 28923854, 29022911, 29067114, 29089565, 29129771, 29141593, 29207674, 29232177, 29247004, 29340103, 29390191, 29402961, 29524224, 29805656, 29847075, 29850392, 30098223, 30214560, 30246033, 30348118, 30483772, 30487062, 30510281, 30729133, 30980038, 30993541, 31434953, 31676993, 31759347, 31803361, 9525738, 9801158, 9822607		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	15496150		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	23051628		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	36128191	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28981594		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18717816		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34544501, 35962130	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22659071		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27048356		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32606289	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	25877996		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25312970, 28570612, 29896915		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15205342, 19483189, 21165568, 22038047, 22200856, 22693251, 24533441, 25222296, 25851596, 26315660, 26337278, 28229621, 29416729, 31297035, 31534543		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19342371, 20562526		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17803693, 26475177, 28926107, 30622557		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17803693	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26374448, 26475177, 34001235, 34210318, 34384444, 34544501, 34753501, 35059043, 35641515, 36151575, 36324080, 36497195, 36517810, 36837510	Associate	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	28878269		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	17460461, 19287309, 19716156, 30993541		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	31236330		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	28944844		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27733448		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25815782	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15050898, 17699771, 21471610, 31676993		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	16421247, 27338044, 31676993	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17699771		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33886809	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11032026, 11696424, 11863219		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30304446		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	15674352		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26503358, 30487062, 31228941		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11696424, 34813586	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20583256, 21949119, 30678426, 31228941, 31410434, 35622184	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oxyphilic Adenoma	Oxyphilic Adenoma	LHGDN	12810205		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17471232, 19665245, 22041584, 22194465, 23019415, 24949874, 26065715, 30483772, 30805811		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17471232, 18802406		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15969750		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12402154, 15969750, 22041584, 24949874, 29270591, 32633891, 37775715	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	18237401	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30404014		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28611342		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24255086, 30214560		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	11076533		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	12970324		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23640536, 25173401, 27590583, 28780195, 29708514, 30112966		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25173401	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	20062060, 22544366, 29892015		★☆☆☆☆ Found in Text Mining only
PARTIAL LIPODYSTROPHY, CONGENITAL CATARACTS, AND NEURODEGENERATION SYNDROME	Partial Lipodystrophy, Congenital Cataracts, And Neurodegeneration Syndrome	GENOMICS_ENGLAND_DG	18211975, 23049990		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PARTIAL LIPODYSTROPHY, CONGENITAL CATARACTS, AND NEURODEGENERATION SYNDROME	Partial Lipodystrophy, Congenital Cataracts, And Neurodegeneration Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PARTIAL LIPODYSTROPHY, CONGENITAL CATARACTS, AND NEURODEGENERATION SYNDROME	Partial Lipodystrophy, Congenital Cataracts, And Neurodegeneration Syndrome	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Periodontitis	Periodontitis	BEFREE	18543249		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	23428975	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27981790	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26566034		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	21697238	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22904171		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22904171, 28004769	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	26176221		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	30304446		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31391685		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	28114583		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10918582, 11170154, 11389065, 11751529, 11920460, 14645548, 15948133, 16077921, 16707439, 16886623, 17943731, 18245473, 18406871, 18635524, 18635971, 19186008, 19581923, 19903767, 19923922, 20209490, 20466611, 20732728, 21378366, 22075971, 22144662, 23203033, 23352616, 23482776, 23645736, 23729330, 23934233, 24222128, 24375805, 25942420, 27764093, 28697756, 28710901, 29402961, 30424755, 30871022, 31081050, 31685812, 9734401		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	19556867	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	28259631	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	22144662		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11571633, 12185081, 12402154, 14645548, 16886623, 17855368, 19763272, 20209490, 20466611, 21373757, 21804603, 22030351, 23302227, 23729330, 23934233, 25942420, 26158290, 27764093, 29402961, 30424755, 33964050, 34596356, 36036057, 36869937, 38065913	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12185081, 15466889, 15948133, 17299799, 17707459, 17855368, 19116988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15948133, 18635971, 21378366, 24123650, 27764093, 28112237, 30871022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15948133, 22159333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19556867, 28697756	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33964050	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasiform eczema	Psoriasiform eczema	BEFREE	26134945		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23206456, 26134945, 30644419		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	23206456		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22215724, 22474227, 23883380, 24835767, 27470556, 27717241, 27771236, 29069575, 29286128, 30943774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	22474227, 25898808, 26820968, 27717241, 28904206, 32159364, 34349187, 34900561, 35346192, 37039367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	GENOMICS_ENGLAND_DG	29650961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22829758, 26539466, 37077366, 37447386	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	20157570		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17178917, 17478448, 18203815, 18949888, 22140072, 27937011, 31629729, 31826982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17178917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37898439	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Hypertension, Primary, 1	Pulmonary Hypertension	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Hypertension, Primary, 1, With Hereditary Hemorrhagic Telangiectasia	Pulmonary Hypertension With Hereditary Hemorrhagic Telangiectasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
PULMONARY HYPERTENSION, PRIMARY, 3	Pulmonary Hypertension	CLINVAR_DG	22474227, 25898808		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PULMONARY HYPERTENSION, PRIMARY, 3	Pulmonary Hypertension	GENOMICS_ENGLAND_DG	29650961		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Renal carcinoma	Renal Carcinoma	BEFREE	21473727, 25273173, 28684115		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14612902, 21473727, 25246063, 26043775, 28684115		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	14612902, 17594718		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	23051628, 30778103		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	27613621		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30954225		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21794046		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11956106, 18458534, 19234134		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	19234134	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16055201, 24427291, 25313138, 25822667, 30771426		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28321538, 30079994		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37793334	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	17342767	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26323261	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11238032, 17487380, 21471610, 24533441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	11238032, 24533441	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	19609943, 21373757, 23185447	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	11238032	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	22832607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	27832597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	18203815, 21670602, 28420992		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma, Limited	Scleroderma	ORPHANET_DG	22402147		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	23401567	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Open Angle Glaucoma	Open Angle Glaucoma	CTD_human_DG	20835238		★☆☆☆☆ Found in Text Mining only
Secondary physiologic amenorrhea	Secondary Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	23836408, 28000867, 28957875, 31534550, 31545263, 31692534		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	33531603	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20061557	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35822943	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27321703		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15205342, 19718715, 22406084, 22564243		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19718715	Inhibit	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29479989	Associate	★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15375584, 16541313		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11920460, 12372346, 17671707, 17906498, 19002186		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	14719121, 15331180, 15856296, 16328005, 17906498, 20047843, 20406988, 21165568, 22213373, 22474125, 26138391, 28243118, 28554768, 31297035		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11920460, 17671707, 25271040, 26768616, 28243118, 29288243		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20558341, 25337248, 25633184, 26474461, 31907776, 33739025, 33774714, 36830672, 36989864, 37047005, 37233885, 39354061	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22200856, 29850392		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21109942, 26474461, 31807160		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	21545202		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20558341, 25633184, 28243118		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28570612		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17875691, 22370641, 23203033, 23592983, 24065198, 24070739, 24778029, 25339030, 25798057, 26817615, 28365694, 28828003, 29089565		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 20626849, 23203033, 23527097, 24065198, 25407491, 25798057, 29089565, 29141593, 30015970, 31886120, 36418919, 36981021, 37919422, 38438090, 39762768	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	29141593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
synovial sarcoma	Synovial sarcoma	BEFREE	11238032		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18203815, 18759267, 18949888, 21670602, 22277251, 22402147, 28420992, 29259049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26566034		★☆☆☆☆ Found in Text Mining only
Talipes transversoplanus	Talipes Transversoplanus	HPO_DG			★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	16328005		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11953823	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23023191	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22513979, 26633361		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22513979, 26633361		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24885050, 26633361, 28273809, 37907864	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	29877208	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	20558341	Stimulate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25633184	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	22353809		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	18612310, 20431349, 29169152, 37432976, 39596307	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25085904, 28735300, 29169152		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22353809, 27338044, 31199921	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	38554019	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	18836420	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28440485, 28498397	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24909339, 26416628		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29847075		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30233709		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	14962949, 17584106, 26433014, 30943774		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23894397, 34873055, 36357389	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23894397		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	23894397	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	24572674, 25525164	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	17460461, 19287309, 19716156, 30993541		★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★☆☆☆☆ Found in Text Mining only