Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8569
Gene name	MAPK interacting serine/threonine kinase 1
Gene symbol	MKNK1
Synonyms (NCBI Gene)	MNK1
Chromosome	1
Chromosome location	1p33
Summary	This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029104	hsa-miR-26b-5p	Microarray	19088304
MIRT755610	hsa-miR-223-3p	GUS reporter assay	34115574
MIRT1150177	hsa-miR-15a	CLIP-seq
MIRT1150178	hsa-miR-15b	CLIP-seq
MIRT1150179	hsa-miR-16	CLIP-seq
MIRT1150180	hsa-miR-195	CLIP-seq
MIRT1150181	hsa-miR-3200-5p	CLIP-seq
MIRT1150182	hsa-miR-3682-3p	CLIP-seq
MIRT1150183	hsa-miR-424	CLIP-seq
MIRT1150184	hsa-miR-4427	CLIP-seq
MIRT1150185	hsa-miR-4436b-5p	CLIP-seq
MIRT1150186	hsa-miR-4524	CLIP-seq
MIRT1150187	hsa-miR-4680-3p	CLIP-seq
MIRT1150188	hsa-miR-4687-3p	CLIP-seq
MIRT1150189	hsa-miR-4705	CLIP-seq
MIRT1150190	hsa-miR-4719	CLIP-seq
MIRT1150191	hsa-miR-4790-3p	CLIP-seq
MIRT1150192	hsa-miR-497	CLIP-seq
MIRT1150193	hsa-miR-503	CLIP-seq
MIRT1150194	hsa-miR-646	CLIP-seq
MIRT1150195	hsa-miR-1178	CLIP-seq
MIRT1150196	hsa-miR-1200	CLIP-seq
MIRT1150197	hsa-miR-1203	CLIP-seq
MIRT1150198	hsa-miR-1253	CLIP-seq
MIRT1150199	hsa-miR-1305	CLIP-seq
MIRT1150200	hsa-miR-135a	CLIP-seq
MIRT1150201	hsa-miR-135b	CLIP-seq
MIRT1150202	hsa-miR-219-2-3p	CLIP-seq
MIRT1150203	hsa-miR-2964a-3p	CLIP-seq
MIRT1150204	hsa-miR-3074-5p	CLIP-seq
MIRT1150205	hsa-miR-3119	CLIP-seq
MIRT1150206	hsa-miR-3124-3p	CLIP-seq
MIRT1150207	hsa-miR-3125	CLIP-seq
MIRT1150208	hsa-miR-3140-5p	CLIP-seq
MIRT1150209	hsa-miR-3157-5p	CLIP-seq
MIRT1150210	hsa-miR-3160-5p	CLIP-seq
MIRT1150211	hsa-miR-3184	CLIP-seq
MIRT1150212	hsa-miR-3915	CLIP-seq
MIRT1150213	hsa-miR-3916	CLIP-seq
MIRT1150214	hsa-miR-3928	CLIP-seq
MIRT1150215	hsa-miR-423-5p	CLIP-seq
MIRT1150216	hsa-miR-4434	CLIP-seq
MIRT1150217	hsa-miR-4476	CLIP-seq
MIRT1150218	hsa-miR-4516	CLIP-seq
MIRT1150187	hsa-miR-4680-3p	CLIP-seq
MIRT1150219	hsa-miR-4691-3p	CLIP-seq
MIRT1150220	hsa-miR-483-5p	CLIP-seq
MIRT1150221	hsa-miR-583	CLIP-seq
MIRT1150222	hsa-miR-607	CLIP-seq
MIRT1150198	hsa-miR-1253	CLIP-seq
MIRT1150206	hsa-miR-3124-3p	CLIP-seq
MIRT1150210	hsa-miR-3160-5p	CLIP-seq
MIRT1150223	hsa-miR-3609	CLIP-seq
MIRT1150224	hsa-miR-518a-5p	CLIP-seq
MIRT1150225	hsa-miR-520g	CLIP-seq
MIRT1150226	hsa-miR-520h	CLIP-seq
MIRT1150227	hsa-miR-527	CLIP-seq
MIRT1150228	hsa-miR-548ah	CLIP-seq
MIRT2042821	hsa-miR-1206	CLIP-seq
MIRT1150199	hsa-miR-1305	CLIP-seq
MIRT1150177	hsa-miR-15a	CLIP-seq
MIRT1150178	hsa-miR-15b	CLIP-seq
MIRT1150179	hsa-miR-16	CLIP-seq
MIRT1150180	hsa-miR-195	CLIP-seq
MIRT1150206	hsa-miR-3124-3p	CLIP-seq
MIRT1150210	hsa-miR-3160-5p	CLIP-seq
MIRT1150183	hsa-miR-424	CLIP-seq
MIRT1150192	hsa-miR-497	CLIP-seq
MIRT2042822	hsa-miR-505	CLIP-seq
MIRT2042823	hsa-miR-519a	CLIP-seq
MIRT2042824	hsa-miR-519b-3p	CLIP-seq
MIRT2042825	hsa-miR-519c-3p	CLIP-seq
MIRT2042826	hsa-miR-548aa	CLIP-seq
MIRT1150222	hsa-miR-607	CLIP-seq
MIRT1150187	hsa-miR-4680-3p	CLIP-seq
MIRT2390931	hsa-miR-1184	CLIP-seq
MIRT2390932	hsa-miR-4468	CLIP-seq
MIRT2571311	hsa-miR-105	CLIP-seq
MIRT1150195	hsa-miR-1178	CLIP-seq
MIRT2390931	hsa-miR-1184	CLIP-seq
MIRT2571312	hsa-miR-1205	CLIP-seq
MIRT1150177	hsa-miR-15a	CLIP-seq
MIRT1150178	hsa-miR-15b	CLIP-seq
MIRT1150179	hsa-miR-16	CLIP-seq
MIRT1150180	hsa-miR-195	CLIP-seq
MIRT2571313	hsa-miR-205	CLIP-seq
MIRT2571314	hsa-miR-214	CLIP-seq
MIRT2571315	hsa-miR-217	CLIP-seq
MIRT1150181	hsa-miR-3200-5p	CLIP-seq
MIRT2571316	hsa-miR-33a	CLIP-seq
MIRT2571317	hsa-miR-33b	CLIP-seq
MIRT2571318	hsa-miR-3619-5p	CLIP-seq
MIRT1150182	hsa-miR-3682-3p	CLIP-seq
MIRT2571319	hsa-miR-371-5p	CLIP-seq
MIRT2571320	hsa-miR-380	CLIP-seq
MIRT2571321	hsa-miR-3924	CLIP-seq
MIRT2571322	hsa-miR-3977	CLIP-seq
MIRT1150183	hsa-miR-424	CLIP-seq
MIRT2571323	hsa-miR-4269	CLIP-seq
MIRT2571324	hsa-miR-4287	CLIP-seq
MIRT1150184	hsa-miR-4427	CLIP-seq
MIRT1150185	hsa-miR-4436b-5p	CLIP-seq
MIRT2571325	hsa-miR-4469	CLIP-seq
MIRT2571326	hsa-miR-4495	CLIP-seq
MIRT1150186	hsa-miR-4524	CLIP-seq
MIRT1150187	hsa-miR-4680-3p	CLIP-seq
MIRT2571327	hsa-miR-4685-3p	CLIP-seq
MIRT1150188	hsa-miR-4687-3p	CLIP-seq
MIRT2571328	hsa-miR-4690-5p	CLIP-seq
MIRT1150189	hsa-miR-4705	CLIP-seq
MIRT2571329	hsa-miR-4713-5p	CLIP-seq
MIRT2571330	hsa-miR-4718	CLIP-seq
MIRT1150190	hsa-miR-4719	CLIP-seq
MIRT2571331	hsa-miR-4724-3p	CLIP-seq
MIRT2571332	hsa-miR-4762-5p	CLIP-seq
MIRT1150191	hsa-miR-4790-3p	CLIP-seq
MIRT1150192	hsa-miR-497	CLIP-seq
MIRT1150193	hsa-miR-503	CLIP-seq
MIRT2571333	hsa-miR-548v	CLIP-seq
MIRT2571334	hsa-miR-602	CLIP-seq
MIRT1150194	hsa-miR-646	CLIP-seq
MIRT2571335	hsa-miR-761	CLIP-seq
MIRT2571311	hsa-miR-105	CLIP-seq
MIRT1150195	hsa-miR-1178	CLIP-seq
MIRT2571313	hsa-miR-205	CLIP-seq
MIRT2571314	hsa-miR-214	CLIP-seq
MIRT2571315	hsa-miR-217	CLIP-seq
MIRT1150181	hsa-miR-3200-5p	CLIP-seq
MIRT2571316	hsa-miR-33a	CLIP-seq
MIRT2571317	hsa-miR-33b	CLIP-seq
MIRT2571318	hsa-miR-3619-5p	CLIP-seq
MIRT2571320	hsa-miR-380	CLIP-seq
MIRT2571321	hsa-miR-3924	CLIP-seq
MIRT2571323	hsa-miR-4269	CLIP-seq
MIRT1150184	hsa-miR-4427	CLIP-seq
MIRT1150185	hsa-miR-4436b-5p	CLIP-seq
MIRT2571326	hsa-miR-4495	CLIP-seq
MIRT1150187	hsa-miR-4680-3p	CLIP-seq
MIRT1150188	hsa-miR-4687-3p	CLIP-seq
MIRT2571328	hsa-miR-4690-5p	CLIP-seq
MIRT2571330	hsa-miR-4718	CLIP-seq
MIRT2571331	hsa-miR-4724-3p	CLIP-seq
MIRT2571332	hsa-miR-4762-5p	CLIP-seq
MIRT1150191	hsa-miR-4790-3p	CLIP-seq
MIRT2571334	hsa-miR-602	CLIP-seq
MIRT2571335	hsa-miR-761	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9155018, 17130135
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	IBA
GO:0005515	Function	Protein binding	IPI	20936779, 23455922, 23602568, 31980649, 32296183, 32707033, 32814053, 33961781
GO:0005516	Function	Calmodulin binding	IBA
GO:0005524	Function	ATP binding	IDA	9155018
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	9155018
GO:0009931	Function	Calcium-dependent protein serine/threonine kinase activity	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	9155018, 17130135
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
606724	7110	ENSG00000079277

Q9BUB5

Protein name

MAP kinase-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (MAP kinase signal-integrating kinase 1) (MAPK signal-integrating kinase 1) (Mnk1)

Protein function

May play a role in the response to environmental stress and cytokines. Appears to regulate translation by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. {ECO:0000269|PubMed:1146

PDB

2HW6 , 2Y9Q , 5WVD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	50 → 172	Protein kinase domain	Domain
PF00069	Pkinase	203 → 374	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15350534}.

Sequence

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL

Sequence length

465

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway HIF-1 signaling pathway Insulin signaling pathway		Spry regulation of FGF signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	25193863		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28881737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29941989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29941989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27418099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27900644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30705255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30705255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	29683667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17130135, 29269484, 29568373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17130135, 24504069, 26383972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33564073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29576605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28332091, 28766096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30659022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25193863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	18951569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30824167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30221473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29045529	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37864471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31014565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25403230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	30659022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	30659022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28332091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	28674170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20648000, 21406405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21406405, 29042487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30824167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	18951569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30659022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31894299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26044548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29576605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24551240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17130135, 17828301, 29269484, 29568373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28766096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28043914, 28164761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30824167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29568373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25193863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25193863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31740775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Menkes Kinky Hair Syndrome	Menkes Kinky Hair Syndrome	BEFREE	16211579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30496989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22370634, 26976208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24551240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31014565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29576605, 30824167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30798328		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28766096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30705255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33971627, 37460872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31014565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33564073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29045529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	29045529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29568373, 30832411		★★★★★ ★☆☆☆☆ Found in Text Mining only

MKNK1 (MAPK interacting serine/threonine kinase 1)