Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8564
Gene name	Kynurenine 3-monooxygenase
Gene symbol	KMO
Synonyms (NCBI Gene)	dJ317G22.1
Chromosome	1
Chromosome location	1q43
Summary	This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. [provi

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT512965	hsa-miR-4803	PAR-CLIP	22012620
MIRT512964	hsa-miR-302f	PAR-CLIP	22012620
MIRT528926	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT528925	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT512962	hsa-miR-3143	PAR-CLIP	22012620
MIRT512961	hsa-miR-106a-3p	PAR-CLIP	22012620
MIRT512960	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT512965	hsa-miR-4803	PAR-CLIP	23446348
MIRT512964	hsa-miR-302f	PAR-CLIP	23446348
MIRT512963	hsa-miR-6793-3p	PAR-CLIP	23446348
MIRT512962	hsa-miR-3143	PAR-CLIP	23446348
MIRT512961	hsa-miR-106a-3p	PAR-CLIP	23446348
MIRT512960	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT738677	hsa-miR-3682-3p	HITS-CLIP	33718276
MIRT512965	hsa-miR-4803	PAR-CLIP	22012620
MIRT512964	hsa-miR-302f	PAR-CLIP	22012620
MIRT528926	hsa-miR-501-3p	PAR-CLIP	22012620
MIRT528925	hsa-miR-502-3p	PAR-CLIP	22012620
MIRT512962	hsa-miR-3143	PAR-CLIP	22012620
MIRT512961	hsa-miR-106a-3p	PAR-CLIP	22012620
MIRT512960	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT512965	hsa-miR-4803	PAR-CLIP	23446348
MIRT512964	hsa-miR-302f	PAR-CLIP	23446348
MIRT512963	hsa-miR-6793-3p	PAR-CLIP	23446348
MIRT512962	hsa-miR-3143	PAR-CLIP	23446348
MIRT512961	hsa-miR-106a-3p	PAR-CLIP	23446348
MIRT512960	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT1099421	hsa-miR-1183	CLIP-seq
MIRT1099422	hsa-miR-3121-3p	CLIP-seq
MIRT1099423	hsa-miR-3122	CLIP-seq
MIRT1099424	hsa-miR-3200-5p	CLIP-seq
MIRT1099425	hsa-miR-337-3p	CLIP-seq
MIRT1099426	hsa-miR-339-5p	CLIP-seq
MIRT1099427	hsa-miR-3607-3p	CLIP-seq
MIRT1099428	hsa-miR-3675-5p	CLIP-seq
MIRT1099429	hsa-miR-3689a-3p	CLIP-seq
MIRT1099430	hsa-miR-3689c	CLIP-seq
MIRT1099431	hsa-miR-382	CLIP-seq
MIRT1099432	hsa-miR-3913-5p	CLIP-seq
MIRT1099433	hsa-miR-3929	CLIP-seq
MIRT739500	hsa-miR-3976	CLIP-seq
MIRT1099434	hsa-miR-4419b	CLIP-seq
MIRT1099435	hsa-miR-4426	CLIP-seq
MIRT1099436	hsa-miR-4478	CLIP-seq
MIRT1099437	hsa-miR-4540	CLIP-seq
MIRT1099438	hsa-miR-4647	CLIP-seq
MIRT1099439	hsa-miR-4662b	CLIP-seq
MIRT1099440	hsa-miR-4693-5p	CLIP-seq
MIRT1099441	hsa-miR-4728-5p	CLIP-seq
MIRT1099442	hsa-miR-485-5p	CLIP-seq
MIRT1099443	hsa-miR-486-5p	CLIP-seq
MIRT1099444	hsa-miR-548c-3p	CLIP-seq
MIRT1099445	hsa-miR-618	CLIP-seq
MIRT1099446	hsa-miR-676	CLIP-seq
MIRT1099447	hsa-miR-891a	CLIP-seq
MIRT2026968	hsa-miR-1225-3p	CLIP-seq
MIRT2026969	hsa-miR-1233	CLIP-seq
MIRT2026970	hsa-miR-1246	CLIP-seq
MIRT2026971	hsa-miR-1273e	CLIP-seq
MIRT2026972	hsa-miR-137	CLIP-seq
MIRT2026973	hsa-miR-147	CLIP-seq
MIRT2026974	hsa-miR-1827	CLIP-seq
MIRT2026975	hsa-miR-2052	CLIP-seq
MIRT2026976	hsa-miR-2467-3p	CLIP-seq
MIRT1099423	hsa-miR-3122	CLIP-seq
MIRT2026977	hsa-miR-3612	CLIP-seq
MIRT2026978	hsa-miR-3616-5p	CLIP-seq
MIRT2026979	hsa-miR-3647-5p	CLIP-seq
MIRT2026980	hsa-miR-3667-3p	CLIP-seq
MIRT1099429	hsa-miR-3689a-3p	CLIP-seq
MIRT1099430	hsa-miR-3689c	CLIP-seq
MIRT1099432	hsa-miR-3913-5p	CLIP-seq
MIRT2026981	hsa-miR-3919	CLIP-seq
MIRT1099433	hsa-miR-3929	CLIP-seq
MIRT2026982	hsa-miR-4257	CLIP-seq
MIRT2026983	hsa-miR-4282	CLIP-seq
MIRT2026984	hsa-miR-4289	CLIP-seq
MIRT1099434	hsa-miR-4419b	CLIP-seq
MIRT2026985	hsa-miR-4459	CLIP-seq
MIRT1099436	hsa-miR-4478	CLIP-seq
MIRT2026986	hsa-miR-4684-5p	CLIP-seq
MIRT2026987	hsa-miR-4695-5p	CLIP-seq
MIRT1099441	hsa-miR-4728-5p	CLIP-seq
MIRT2026988	hsa-miR-4761-5p	CLIP-seq
MIRT2026989	hsa-miR-4768-5p	CLIP-seq
MIRT2026990	hsa-miR-4795-5p	CLIP-seq
MIRT2026991	hsa-miR-4802-3p	CLIP-seq
MIRT1099442	hsa-miR-485-5p	CLIP-seq
MIRT2026992	hsa-miR-490-5p	CLIP-seq
MIRT1099444	hsa-miR-548c-3p	CLIP-seq
MIRT2026993	hsa-miR-573	CLIP-seq
MIRT2026994	hsa-miR-650	CLIP-seq
MIRT2026995	hsa-miR-665	CLIP-seq
MIRT2258192	hsa-miR-1182	CLIP-seq
MIRT2258193	hsa-miR-1229	CLIP-seq
MIRT2258194	hsa-miR-133a	CLIP-seq
MIRT2258195	hsa-miR-133b	CLIP-seq
MIRT2026973	hsa-miR-147	CLIP-seq
MIRT2258196	hsa-miR-193a-3p	CLIP-seq
MIRT2258197	hsa-miR-193b	CLIP-seq
MIRT2258198	hsa-miR-197	CLIP-seq
MIRT2258199	hsa-miR-3145-3p	CLIP-seq
MIRT2258200	hsa-miR-3176	CLIP-seq
MIRT2026980	hsa-miR-3667-3p	CLIP-seq
MIRT2258201	hsa-miR-3672	CLIP-seq
MIRT2258202	hsa-miR-3689a-5p	CLIP-seq
MIRT2258203	hsa-miR-3689b	CLIP-seq
MIRT2258204	hsa-miR-3689e	CLIP-seq
MIRT2258205	hsa-miR-3689f	CLIP-seq
MIRT2258206	hsa-miR-3922-3p	CLIP-seq
MIRT2258207	hsa-miR-3977	CLIP-seq
MIRT2258208	hsa-miR-421	CLIP-seq
MIRT2026984	hsa-miR-4289	CLIP-seq
MIRT2258209	hsa-miR-4303	CLIP-seq
MIRT2258210	hsa-miR-4433	CLIP-seq
MIRT2258211	hsa-miR-4463	CLIP-seq
MIRT2258212	hsa-miR-4649-3p	CLIP-seq
MIRT2258213	hsa-miR-4709-5p	CLIP-seq
MIRT2258214	hsa-miR-4720-3p	CLIP-seq
MIRT2258215	hsa-miR-4729	CLIP-seq
MIRT2258216	hsa-miR-4766-5p	CLIP-seq
MIRT2258217	hsa-miR-4775	CLIP-seq
MIRT2258218	hsa-miR-4793-3p	CLIP-seq
MIRT2258219	hsa-miR-4797-5p	CLIP-seq
MIRT2258220	hsa-miR-4804-3p	CLIP-seq
MIRT2258221	hsa-miR-505	CLIP-seq
MIRT2258222	hsa-miR-508-5p	CLIP-seq
MIRT2258223	hsa-miR-590-3p	CLIP-seq
MIRT2258224	hsa-miR-651	CLIP-seq
MIRT2258225	hsa-miR-656	CLIP-seq
MIRT2026995	hsa-miR-665	CLIP-seq
MIRT1099446	hsa-miR-676	CLIP-seq
MIRT2258226	hsa-miR-766	CLIP-seq
MIRT2026968	hsa-miR-1225-3p	CLIP-seq
MIRT2258193	hsa-miR-1229	CLIP-seq
MIRT2026969	hsa-miR-1233	CLIP-seq
MIRT2258198	hsa-miR-197	CLIP-seq
MIRT2258199	hsa-miR-3145-3p	CLIP-seq
MIRT1099431	hsa-miR-382	CLIP-seq
MIRT2258208	hsa-miR-421	CLIP-seq
MIRT2258213	hsa-miR-4709-5p	CLIP-seq
MIRT2258218	hsa-miR-4793-3p	CLIP-seq
MIRT2258221	hsa-miR-505	CLIP-seq
MIRT2258222	hsa-miR-508-5p	CLIP-seq
MIRT2026995	hsa-miR-665	CLIP-seq
MIRT2258226	hsa-miR-766	CLIP-seq
MIRT2452714	hsa-miR-200b	CLIP-seq
MIRT2452715	hsa-miR-200c	CLIP-seq
MIRT1099424	hsa-miR-3200-5p	CLIP-seq
MIRT2452716	hsa-miR-369-3p	CLIP-seq
MIRT2452717	hsa-miR-429	CLIP-seq
MIRT2452718	hsa-miR-4428	CLIP-seq
MIRT2452719	hsa-miR-493	CLIP-seq
MIRT2452714	hsa-miR-200b	CLIP-seq
MIRT2452715	hsa-miR-200c	CLIP-seq
MIRT2452716	hsa-miR-369-3p	CLIP-seq
MIRT2452717	hsa-miR-429	CLIP-seq
MIRT2452719	hsa-miR-493	CLIP-seq
MIRT739500	hsa-miR-3976	CLIP-seq
MIRT2559138	hsa-miR-4307	CLIP-seq
MIRT2559139	hsa-miR-4753-3p	CLIP-seq
MIRT2026989	hsa-miR-4768-5p	CLIP-seq
MIRT2559140	hsa-miR-513a-3p	CLIP-seq
MIRT2559138	hsa-miR-4307	CLIP-seq
MIRT2559139	hsa-miR-4753-3p	CLIP-seq
MIRT2026989	hsa-miR-4768-5p	CLIP-seq
MIRT2559140	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004502	Function	Kynurenine 3-monooxygenase activity	IBA
GO:0004502	Function	Kynurenine 3-monooxygenase activity	IDA	9237672, 10672018, 23575632, 26752518, 29208702, 29429898
GO:0004502	Function	Kynurenine 3-monooxygenase activity	IEA
GO:0004502	Function	Kynurenine 3-monooxygenase activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005615	Component	Extracellular space	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	ISS	10672018
GO:0005829	Component	Cytosol	TAS
GO:0006569	Process	L-tryptophan catabolic process	IEA
GO:0006569	Process	L-tryptophan catabolic process	TAS
GO:0009435	Process	NAD+ biosynthetic process	IEA
GO:0009651	Process	Response to salt stress	IDA	10672018
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IDA	10672018, 23575632, 29429898
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019363	Process	Pyridine nucleotide biosynthetic process	IEA
GO:0019674	Process	NAD+ metabolic process	IDA	23575632, 29429898
GO:0019674	Process	NAD+ metabolic process	IEA
GO:0019805	Process	Quinolinate biosynthetic process	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034276	Process	Kynurenic acid biosynthetic process	IEA
GO:0034354	Process	'de novo' NAD+ biosynthetic process from L-tryptophan	IEA
GO:0043420	Process	Anthranilate metabolic process	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IDA	10672018
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0070189	Process	Kynurenine metabolic process	IBA
GO:0070189	Process	Kynurenine metabolic process	IDA	10672018, 26752518, 29208702, 29429898
GO:0070189	Process	Kynurenine metabolic process	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071949	Function	FAD binding	IDA	29429898
GO:0071949	Function	FAD binding	IEA
GO:0097052	Process	L-kynurenine metabolic process	IEA
GO:1903296	Process	Positive regulation of glutamate secretion, neurotransmission	IEA

MIM	HGNC	e!Ensembl
603538	6381	ENSG00000117009

O15229

Protein name

Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase)

Protein function

Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn) (PubMed:23575632, PubMed:26752518, PubMed:28604669, PubMed:29208702, PubMed:29429898). Required for synthesis of quinolinic acid, a neurotoxic NMDA rec

PDB

5X68

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01494	FAD_binding_3	8 → 331	FAD binding domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highest levels in placenta and liver. Detectable in kidney. {ECO:0000269|PubMed:9237672}.

Sequence

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR

Sequence length

486

Interactions

View interactions

	KEGG		Reactome
	Tryptophan metabolism Metabolic pathways Biosynthesis of cofactors		Tryptophan catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KMO-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	26752518, 28336141, 28398044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	33298635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	23459468, 28241062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	23459468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33109232	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33887987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33887987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26099564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32390008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38183155	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31434983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	21492941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28319697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	34440798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34440798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15806102, 21044956, 28398044, 29420107, 29856028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26099564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34948292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30760699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21492941, 22683764, 27693848		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21492941, 22683764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver	Liver Cancer	BEFREE	30296239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31186637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	23459468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28187857, 29879409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37410216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31462737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31462737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25554480, 31186637, 31434983, 31781097		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29208702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33887987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28604669, 29420107, 29429898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30050435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	26142836, 27245499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26347385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	8412323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	8412323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	26142836, 27245499, 28187857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16716206, 21693093, 21727251, 23459468, 25464917, 26142836, 27245499, 28187857, 29879409, 30354938		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16716206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16716206, 21693093, 21727251, 23459468, 25464917		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23459468	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	23459468	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	31285277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32117235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	21492941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21492941, 22683764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

KMO (kynurenine 3-monooxygenase)