Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8558
Gene name	Cyclin dependent kinase 10
Gene symbol	CDK10
Synonyms (NCBI Gene)	ALSASPISSLRE
Chromosome	16
Chromosome location	16q24.3
Summary	The protein encoded by this gene belongs to the CDK subfamily of the Ser/Thr protein kinase family. The CDK subfamily members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and are known to be essential for cell cycle p

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs767176610	G>A	Pathogenic	Splice acceptor variant
rs771066826	G>A,T	Pathogenic	Splice donor variant
rs772157816	G>A	Likely-pathogenic	Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1060499745	C>G,T	Likely-pathogenic	Genic downstream transcript variant, non coding transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs1555516716	G>-	Pathogenic	Frameshift variant, intron variant, 5 prime UTR variant, coding sequence variant
rs1597864006	CTGGCCC>-	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant

104

Show/Hide all (104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003168	hsa-miR-210-3p	immunoprecipitaionMicroarrayqRT-PCR	19826008
MIRT004208	hsa-miR-197-3p	Microarray	16822819
MIRT880201	hsa-miR-1273g	CLIP-seq
MIRT880202	hsa-miR-1285	CLIP-seq
MIRT880203	hsa-miR-1324	CLIP-seq
MIRT880204	hsa-miR-151-5p	CLIP-seq
MIRT880205	hsa-miR-151b	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT880207	hsa-miR-1972	CLIP-seq
MIRT880208	hsa-miR-1976	CLIP-seq
MIRT880209	hsa-miR-296-5p	CLIP-seq
MIRT880210	hsa-miR-3127-5p	CLIP-seq
MIRT880211	hsa-miR-3166	CLIP-seq
MIRT880212	hsa-miR-3182	CLIP-seq
MIRT880213	hsa-miR-3187-5p	CLIP-seq
MIRT880214	hsa-miR-378g	CLIP-seq
MIRT880215	hsa-miR-3918	CLIP-seq
MIRT880216	hsa-miR-4310	CLIP-seq
MIRT880217	hsa-miR-4314	CLIP-seq
MIRT880218	hsa-miR-4436b-3p	CLIP-seq
MIRT880219	hsa-miR-4474-3p	CLIP-seq
MIRT880220	hsa-miR-4474-5p	CLIP-seq
MIRT880221	hsa-miR-4486	CLIP-seq
MIRT880222	hsa-miR-4488	CLIP-seq
MIRT880223	hsa-miR-4519	CLIP-seq
MIRT880224	hsa-miR-4667-5p	CLIP-seq
MIRT880225	hsa-miR-4685-5p	CLIP-seq
MIRT880226	hsa-miR-4697-5p	CLIP-seq
MIRT880227	hsa-miR-4700-5p	CLIP-seq
MIRT880228	hsa-miR-4711-5p	CLIP-seq
MIRT880229	hsa-miR-4726-3p	CLIP-seq
MIRT880230	hsa-miR-4751	CLIP-seq
MIRT880231	hsa-miR-486-3p	CLIP-seq
MIRT880232	hsa-miR-493	CLIP-seq
MIRT880233	hsa-miR-612	CLIP-seq
MIRT880234	hsa-miR-637	CLIP-seq
MIRT1960783	hsa-miR-150	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT1960784	hsa-miR-2355-3p	CLIP-seq
MIRT1960785	hsa-miR-3909	CLIP-seq
MIRT880228	hsa-miR-4711-5p	CLIP-seq
MIRT1960786	hsa-miR-483-3p	CLIP-seq
MIRT1960787	hsa-miR-676	CLIP-seq
MIRT2197443	hsa-miR-1301	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT880207	hsa-miR-1972	CLIP-seq
MIRT880208	hsa-miR-1976	CLIP-seq
MIRT880220	hsa-miR-4474-5p	CLIP-seq
MIRT2197444	hsa-miR-4660	CLIP-seq
MIRT880225	hsa-miR-4685-5p	CLIP-seq
MIRT2197445	hsa-miR-4690-3p	CLIP-seq
MIRT880229	hsa-miR-4726-3p	CLIP-seq
MIRT2197446	hsa-miR-5047	CLIP-seq
MIRT2197447	hsa-miR-766	CLIP-seq
MIRT2385845	hsa-miR-1225-3p	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT880207	hsa-miR-1972	CLIP-seq
MIRT2385846	hsa-miR-3192	CLIP-seq
MIRT2385847	hsa-miR-3943	CLIP-seq
MIRT2385848	hsa-miR-4300	CLIP-seq
MIRT880229	hsa-miR-4726-3p	CLIP-seq
MIRT2385849	hsa-miR-920	CLIP-seq
MIRT2500781	hsa-miR-1184	CLIP-seq
MIRT880202	hsa-miR-1285	CLIP-seq
MIRT2500782	hsa-miR-1288	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT880207	hsa-miR-1972	CLIP-seq
MIRT2500783	hsa-miR-2277-3p	CLIP-seq
MIRT880209	hsa-miR-296-5p	CLIP-seq
MIRT2500784	hsa-miR-3130-3p	CLIP-seq
MIRT880212	hsa-miR-3182	CLIP-seq
MIRT880213	hsa-miR-3187-5p	CLIP-seq
MIRT2500785	hsa-miR-3199	CLIP-seq
MIRT880214	hsa-miR-378g	CLIP-seq
MIRT880217	hsa-miR-4314	CLIP-seq
MIRT880221	hsa-miR-4486	CLIP-seq
MIRT2500786	hsa-miR-4534	CLIP-seq
MIRT2500787	hsa-miR-4652-5p	CLIP-seq
MIRT2500788	hsa-miR-4691-3p	CLIP-seq
MIRT880229	hsa-miR-4726-3p	CLIP-seq
MIRT2500789	hsa-miR-4781-5p	CLIP-seq
MIRT2500790	hsa-miR-4786-5p	CLIP-seq
MIRT880232	hsa-miR-493	CLIP-seq
MIRT880233	hsa-miR-612	CLIP-seq
MIRT2500791	hsa-miR-769-5p	CLIP-seq
MIRT2500792	hsa-miR-888	CLIP-seq
MIRT880202	hsa-miR-1285	CLIP-seq
MIRT2500782	hsa-miR-1288	CLIP-seq
MIRT880206	hsa-miR-1915	CLIP-seq
MIRT880207	hsa-miR-1972	CLIP-seq
MIRT2500783	hsa-miR-2277-3p	CLIP-seq
MIRT880209	hsa-miR-296-5p	CLIP-seq
MIRT880212	hsa-miR-3182	CLIP-seq
MIRT880213	hsa-miR-3187-5p	CLIP-seq
MIRT2500785	hsa-miR-3199	CLIP-seq
MIRT880214	hsa-miR-378g	CLIP-seq
MIRT880217	hsa-miR-4314	CLIP-seq
MIRT880221	hsa-miR-4486	CLIP-seq
MIRT2500787	hsa-miR-4652-5p	CLIP-seq
MIRT880229	hsa-miR-4726-3p	CLIP-seq
MIRT2500789	hsa-miR-4781-5p	CLIP-seq
MIRT880232	hsa-miR-493	CLIP-seq
MIRT880233	hsa-miR-612	CLIP-seq
MIRT2500792	hsa-miR-888	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IPI	24218572
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	27104747
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS	8084611
GO:0005515	Function	Protein binding	IPI	18242510, 22158035, 22939624, 24218572, 27104747, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11006117
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007089	Process	Traversing start control point of mitotic cell cycle	TAS	8208557
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8208557
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	27104747
GO:0030030	Process	Cell projection organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	27104747
GO:0036064	Component	Ciliary basal body	IDA	27104747
GO:0042995	Component	Cell projection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0097472	Function	Cyclin-dependent protein kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902018	Process	Negative regulation of cilium assembly	IMP	27104747
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IDA	7664269

MIM	HGNC	e!Ensembl
603464	1770	ENSG00000185324

Q15131

Protein name

Cyclin-dependent kinase 10 (EC 2.7.11.22) (Cell division protein kinase 10) (Serine/threonine-protein kinase PISSLRE)

Protein function

Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells) (PubMed:24218572). Involved in the regulation of actin cytoskeleton organization through the phos

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	39 → 323	Protein kinase domain	Domain

Sequence

MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQ
TDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYC
EQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTA
DFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLP
GTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLL
HFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP

Sequence length

360

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal brain morphology	Likely pathogenic	rs1060499745	RCV000454194	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Al Kaissi syndrome	Likely pathogenic; Pathogenic	rs766960979, rs1567520269, rs2151576627, rs2543715086, rs943211778, rs1303728412, rs2543559184, rs2060398790, rs2543628290, rs2543666277, rs2543666566, rs2543680967, rs2543713603, rs767176610, rs1555516716 View all (5 more)	RCV001526542 RCV005253855 RCV002245281 RCV002465013 RCV003329147 View all (15 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Global developmental delay	Pathogenic	rs767833852	RCV002285125	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDK10-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19846932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	29130579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of Corpus Callosum	Corpus callosum agenesis	Pubtator	29130579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AL KAISSI SYNDROME	AL KAISSI SYNDROME	GENOMICS_ENGLAND_DG	28886341		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AL KAISSI SYNDROME	AL KAISSI SYNDROME	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Alzheimer Disease	Alzheimer disease	Pubtator	36988771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	22209942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	22209942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10036189, 18242507, 18242510, 19846932, 22158035, 22209942, 28178678, 29512714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18242507, 18242510, 19846932, 26209438, 33686962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33248005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	29130579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	29130579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28663269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32345988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	29130579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34369103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	9628816		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	9628816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29845196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Growth Disorders	Growth disorder	Pubtator	28744006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	28886341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22326270, 23740091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12878869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	11756183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	11756183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10036189, 18242507, 18242510, 19846932, 22158035, 22209942, 28178678, 29512714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29435072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29512714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22209942, 28178678, 7882308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10036189		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	GWASDB_DG	19578364, 21706340, 21926416, 21983787, 24980573		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	19578364, 21983787, 24980573, 28212542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	19578364, 23393597, 33248005	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23740091, 29512714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10036189, 18242510, 19236379, 22209942, 28178678, 28663269, 28928881, 29512714, 29845196, 7882308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26683928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	26683928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28928881, 29512714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synophrys	Synophrys	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Toe Syndactyly Telecanthus and Anogenital and Renal Malformations	Toe syndactyly-telecanthus-anogenital and renal malformations syndrome	Pubtator	27104747, 29130579, 34369103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TOE SYNDACTYLY, TELECANTHUS, AND ANOGENITAL AND RENAL MALFORMATIONS	Toe Syndactyly, Telecanthus, And Anogenital And Renal Malformations	BEFREE	24218572, 27104747		★★★★★ ★☆☆☆☆ Found in Text Mining only

CDK10 (cyclin dependent kinase 10)