TSLP (thymic stromal lymphopoietin)

Gene

• Entrez ID: 85480
• Gene name: Thymic stromal lymphopoietin
• Gene symbol: TSLP
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q22.1
• Summary: This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attract

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017769	hsa-miR-335-5p	Microarray	18185580
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT527990	hsa-miR-652-5p	PAR-CLIP	22012620
MIRT527989	hsa-miR-6732-3p	PAR-CLIP	22012620
MIRT527988	hsa-miR-4323	PAR-CLIP	22012620
MIRT527987	hsa-miR-3943	PAR-CLIP	22012620
MIRT527986	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT527985	hsa-miR-211-3p	PAR-CLIP	22012620
MIRT527984	hsa-miR-4270	PAR-CLIP	22012620
MIRT527983	hsa-miR-4441	PAR-CLIP	22012620
MIRT527982	hsa-miR-6754-5p	PAR-CLIP	22012620
MIRT527981	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT527980	hsa-miR-1266-5p	PAR-CLIP	22012620
MIRT527979	hsa-miR-4518	PAR-CLIP	22012620
MIRT527978	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT527977	hsa-miR-299-5p	PAR-CLIP	22012620
MIRT2358610	hsa-miR-128	CLIP-seq
MIRT2358611	hsa-miR-1305	CLIP-seq
MIRT2358612	hsa-miR-27a	CLIP-seq
MIRT2358613	hsa-miR-27b	CLIP-seq
MIRT2358614	hsa-miR-302a	CLIP-seq
MIRT2358615	hsa-miR-302b	CLIP-seq
MIRT2358616	hsa-miR-302c	CLIP-seq
MIRT2358617	hsa-miR-302d	CLIP-seq
MIRT2358618	hsa-miR-302e	CLIP-seq
MIRT2358619	hsa-miR-3692	CLIP-seq
MIRT2358620	hsa-miR-372	CLIP-seq
MIRT2358621	hsa-miR-373	CLIP-seq
MIRT2358622	hsa-miR-4255	CLIP-seq
MIRT2358623	hsa-miR-4659a-3p	CLIP-seq
MIRT2358624	hsa-miR-4659b-3p	CLIP-seq
MIRT2358625	hsa-miR-4719	CLIP-seq
MIRT2358626	hsa-miR-4778-3p	CLIP-seq
MIRT2358627	hsa-miR-513b	CLIP-seq
MIRT2358628	hsa-miR-519a	CLIP-seq
MIRT2358629	hsa-miR-519b-3p	CLIP-seq
MIRT2358630	hsa-miR-519c-3p	CLIP-seq
MIRT2358631	hsa-miR-520a-3p	CLIP-seq
MIRT2358632	hsa-miR-520b	CLIP-seq
MIRT2358633	hsa-miR-520c-3p	CLIP-seq
MIRT2358634	hsa-miR-520d-3p	CLIP-seq
MIRT2358635	hsa-miR-520e	CLIP-seq
MIRT2358636	hsa-miR-548t	CLIP-seq
MIRT2358637	hsa-miR-607	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	22270071
RELA	Unknown	22270071

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IBA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IDA	11418668
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	11418668, 20974963
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IMP	17242164
GO:0005139	Function	Interleukin-7 receptor binding	IBA
GO:0005139	Function	Interleukin-7 receptor binding	IMP	11480573
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	11418668, 17242164, 24850429
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IMP	11480573
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	11418668, 35321112
GO:0005615	Component	Extracellular space	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	11480573
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11418668
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	11480573
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	10881176
GO:0032722	Process	Positive regulation of chemokine production	IBA
GO:0032722	Process	Positive regulation of chemokine production	IDA	11418668
GO:0032733	Process	Positive regulation of interleukin-10 production	IBA
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	17242164
GO:0032736	Process	Positive regulation of interleukin-13 production	IBA
GO:0032736	Process	Positive regulation of interleukin-13 production	IMP	17242164
GO:0032754	Process	Positive regulation of interleukin-5 production	IBA
GO:0032754	Process	Positive regulation of interleukin-5 production	IMP	17242164
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	17242164
GO:0033005	Process	Positive regulation of mast cell activation	IMP	17242164
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	11480573
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11480573
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	17242164
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	24850429
GO:0050832	Process	Defense response to fungus	IDA	24850429
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	24850429
GO:0071654	Process	Positive regulation of chemokine (C-C motif) ligand 1 production	IMP	17242164
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IMP	17242164
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	24850429
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	11418668, 24850429

Other IDs

• MIM: 607003
• HGNC: 30743
• e!Ensembl: ENSG00000145777

Protein

• UniProt ID: Q969D9
• Protein name: Thymic stromal lymphopoietin
• Protein function: [Isoform 1]: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells. {ECO:00002
• PDB: 5J11, 5J12, 5J13, 8QFZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15216	TSLP	29 → 153	Thymic stromal lymphopoietin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva. {ECO:0000269|PubMed:11480573
• Sequence:

  MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
  TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
  TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Sequence length: 159

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

Interleukin-7 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHURG-STRAUSS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	30988731		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22685175, 24993875, 29296821		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22685175		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29156718		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	18060034, 18720075, 19763625, 20079130, 20924287, 22973903, 23267211, 24190435, 24525665, 25340427, 26428949, 26791024, 27012942, 27376852, 28214951, 29413340, 29752758, 29894863, 30148989, 30737962, 30848348		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	23579771, 26453584, 26712523, 27149122		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37742913	Associate	★☆☆☆☆ Found in Text Mining only
Angioedema	Angioedema	Pubtator	27240835	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30214685		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23485611, 28615347		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17416344		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24641111, 26110994, 30828078		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23190696, 25433812, 25817699, 36726974	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15944327, 17242164, 18684970, 18926564, 18941246, 19539984, 20109311, 20146705, 20560908, 20627922, 20656951, 20663412, 20924287, 20951221, 21468164, 21682736, 21804549, 21966427, 21975173, 22913730, 22948028, 22981788, 23192865, 23267211, 23945177, 23953709, 24341479, 24525665, 24773145, 24831437, 24888572, 25680454, 26119467, 26896329, 26999524, 27365223, 27528425, 27757939, 28137494, 28137499, 28199345, 28224996, 28252235, 28275176, 28303765, 28329851, 28368013, 28400057, 28433687, 28472780, 28658544, 28658558, 28682426, 28765890, 28867182, 28972433, 29024606, 29047096, 29132961, 29222519, 29318959, 29320511, 29343779, 29453280, 29512368, 29670037, 29721367, 29908086, 29940571, 30011850, 30185520, 30431203, 30464333, 30537285, 30588853, 30746204, 30779339, 30861490, 30890137, 30932910, 30976816, 31066119, 31078066, 31275312, 31284925, 31378088, 31392802, 31408015, 31549891, 31577921, 31610614, 31703832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15944327, 17666213, 18684970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15944327, 19055649, 19561109, 20483734, 20560908, 20656951, 20660708, 21468164, 21966427, 22694930, 22913730, 22994343, 23267211, 23541324, 23744438, 24388013, 24573880, 24831437, 24851948, 25055998, 25515628, 25546419, 26119467, 26896329, 28199345, 28682426, 29343779, 29453280, 30185520, 31066119, 31275312, 31378088, 31974622, 32240371, 32302698, 32842623, 33463103, 33836808, 34103634, 34111451, 34331429, 34916261, 35524249, 36674744, 36726974, 37699081, 37996952, 38469627, 40610493	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	17617600, 18684970, 22052771, 28275176	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	21804549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30929738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	23485611, 28615347		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28615347	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28631887, 33029540	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30152851, 31387206, 31464668		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28289419, 29631029		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	31885007	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	33029540	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24356513	Stimulate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	29455734		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21490155, 24033709, 24410591, 29556001, 29915299, 31210014		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31210014, 35472078	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28471975		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	33514798	Stimulate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	29866844		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23150092	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31023965	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31023965		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	30057581, 30821220		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30099039		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29250181, 29344192		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29250181, 29344192		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22685175		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	24831437, 26712523		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	23462911		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22915648		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17513456, 18684970, 21856447, 22881993, 30057581, 30291224, 31078066, 31392802		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17513456, 18684970		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	23688414, 26625351, 29911210, 30888496, 31330219, 31641233, 31830587		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	23200753, 23688414, 31768185		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23303670, 23515135, 28329851		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19757042	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34573368	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	BEFREE	30077805		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30123216		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30123216		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30123216	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30123216		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	23688414, 28199345, 31768185		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20848455, 27697608		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	17322382, 21814168		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25817699		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23524263, 28615416, 28683366, 29310423, 29462589, 30503244, 31301371, 31556482		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	20483734, 21716324, 23639975, 23744438, 24401911, 24573880, 24851948, 25171086, 26288354, 27498343, 27701668, 28364410, 28377574, 29273672, 31491540, 32896640, 33429916, 34070943, 34331429, 35409338, 39766227	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	23379440, 28584210, 34678092, 35065132	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	20656951	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12055625, 16103410, 16880407, 17242164, 19477321, 19609063, 20146705, 20174635, 21576506, 21841801, 21856447, 22948028, 23284675, 23376058, 23379440, 23524263, 23600544, 23639975, 23688403, 23953709, 24341479, 24401911, 24412367, 24510054, 25340427, 25461559, 26147950, 26419317, 26531761, 26712523, 26894419, 27376852, 27498343, 27697608, 27871981, 27902816, 28057434, 28191908, 28219709, 28224996, 28364410, 28368013, 28377574, 28390860, 28530223, 28584210, 28597545, 28655470, 28658558, 28667471, 28833499, 29017796, 29179209, 29222519, 29273672, 29279286, 29310423, 29353040, 29462589, 29740850, 29862299, 30025384, 30042397, 30057581, 30093649, 30183461, 30304837, 30544712, 30550828, 30825337, 30976816, 30991764, 31301371, 31313888, 31325512, 31491540, 31817146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	16880407, 22355542, 23688403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	17666213, 18768889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	28683366, 29279286, 29310423, 29339444, 31350578		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28119693		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	23335246		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	28461505	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12055625, 16103410, 16880407, 17242164, 19477321, 19609063, 20146705, 20174635, 21576506, 21841801, 21856447, 22948028, 23284675, 23376058, 23379440, 23524263, 23600544, 23639975, 23688403, 23953709, 24341479, 24401911, 24412367, 24510054, 25340427, 25461559, 25700684, 26147950, 26419317, 26531761, 26712523, 26894419, 27498343, 27697608, 27902816, 28057434, 28191908, 28219709, 28224996, 28364410, 28368013, 28377574, 28390860, 28530223, 28584210, 28597545, 28655470, 28658558, 28667471, 28833499, 29017796, 29179209, 29222519, 29273672, 29279286, 29310423, 29353040, 29462589, 29740850, 29862299, 30025384, 30042397, 30057581, 30093649, 30183461, 30304837, 30544712, 30550828, 30825337, 30976816, 30991764, 31301371, 31313888, 31325512, 31491540, 31817146		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	36046760	Associate	★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	16880407, 22355542, 23688403		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	22888172		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22888172, 30152851		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24966899, 30152851	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	26047816, 30575775, 31164097, 31350578		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	26047816, 26691435	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	20208534, 20620568, 25340427, 25407941, 25981737, 26119467, 26258919, 27697608, 28224995, 29029802, 29511165, 29774148, 29980278, 30903437, 31132551, 31352605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	CTD_human_DG	20208534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	20208534, 20620568, 25407941, 26119467, 26258919, 29029802, 29129581, 31909633, 32197970, 37699081	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25017104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	26992000, 28712126	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30877129		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30877129		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23889244	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19841072		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	19841072	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	35905420	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	28631887, 30763528	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	CTD_human_DG	17686814		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	21814168		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28584210	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28584210		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23194010		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23194010	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	23194010	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35065132	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25889007	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	23150092	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29156718		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	24573880	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	28278185		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	28278185	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	23744438, 32493875, 33429916, 34707611	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22304237		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24081992	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25680454, 28202030, 31392802, 31581688		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27187742, 29312588		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	23455502, 30123216	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	27733093, 30123216		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30760333		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24573880, 37279927	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27697608		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	23524263, 28615416, 28683366, 29462589, 31301371, 31556482		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	28746197	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	26342013	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29257253, 30676545		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	29550278, 30128494, 30853520		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22685175, 23625073, 25326546, 26611474		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22685175	Associate	★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	28746197		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23150092	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	23150092	Associate	★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	28746197		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	18244952, 28202030, 31392802		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24081992	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	27906425	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28202030		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	27376852		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21681373, 34440780	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26175262, 31023965		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31023965	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	31464668		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	31464668		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	31464668		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27634769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21490155, 24033709, 24410591, 29556001, 29915299, 31210014		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30877129		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30760333		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27869649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26175262		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21490155, 25326546, 26175262, 27634769, 30760333, 31023965, 31575547, 31723054, 31745338		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29250181, 29344192		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24033709		★☆☆☆☆ Found in Text Mining only
Membranoproliferative Glomerulonephritis, Type I	Nephrotic syndrome	CTD_human_DG	17686814		★☆☆☆☆ Found in Text Mining only
Membranoproliferative Glomerulonephritis, Type II	Nephrotic syndrome	CTD_human_DG	17686814		★☆☆☆☆ Found in Text Mining only
Membranoproliferative Glomerulonephritis, Type III	Nephrotic syndrome	CTD_human_DG	17686814		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22304237		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	19757042	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20097866		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26531692, 30827881		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	36046760	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31227217		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20109311, 20924287, 23200753, 23688414, 24583911, 27744031, 30519393, 30746204		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23063330, 26691435, 27050744, 27744031, 29768034, 36840497, 39940994	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23688414, 32085629	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24033709, 26175262, 29721367, 30760333		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	28433687	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22178353, 22304237, 28263381		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	22304237		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29257253		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30760333		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30214685		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	33029540	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	36046760	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	29908086		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26912005		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	28584210, 30809683	Associate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	28631887	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23524263, 24910175, 28833576, 29279286, 30057581, 31682627		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36046760	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17513456, 20483734, 20660708, 21468164, 21691053, 31910693, 32842623, 33486314, 40280536	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18684970, 22881993, 30291224	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23413283, 25680454, 30653976		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	26694802		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18941246		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	18941246		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	26691435	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24641111, 25817699, 26110994, 26694802, 30057581		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	28303765		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	23744438	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Perennial	Rhinitis	Pubtator	34331429	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	29109963		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28202030		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	36046760	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	23413283		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	37742913	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31628890	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31480519, 31628890		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31464668	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25171086, 26288354, 31480216, 36046760	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20146705, 21576506, 24341479, 28134765, 28833499, 29631029, 29862299, 30025384, 30183461, 30991764		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31970439	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26175262		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23335246, 23413283, 27429171, 28681919		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24356513	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26531692		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	23194010		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	35280443	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19757042, 26014813, 27697608, 28928735, 29889228		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	27240835	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27429171		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25889007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	Pubtator	25889007	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Venous thromboembolism	Pubtator	34309635	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19555430, 30368785		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19555430, 30368785		★☆☆☆☆ Found in Text Mining only