Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	85479
Gene name	DnaJ heat shock protein family (Hsp40) member C5 beta
Gene symbol	DNAJC5B
Synonyms (NCBI Gene)	CSP-beta
Chromosome	8
Chromosome location	8q13.1
Summary	This gene encodes a member of the DNAJ heat shock protein 40 family of co-chaperone proteins that is characterized by an N-terminal DNAJ domain, a linker region, and a cysteine-rich C-terminal domain. The encoded protein, together with heat shock protein

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments
MIRT941750	hsa-miR-3119	CLIP-seq
MIRT941751	hsa-miR-3140-3p	CLIP-seq
MIRT941752	hsa-miR-375	CLIP-seq
MIRT941753	hsa-miR-4273	CLIP-seq
MIRT941754	hsa-miR-4677-5p	CLIP-seq
MIRT941755	hsa-miR-4796-3p	CLIP-seq
MIRT941756	hsa-miR-548t	CLIP-seq
MIRT1978766	hsa-miR-3173-3p	CLIP-seq
MIRT1978767	hsa-miR-4269	CLIP-seq
MIRT1978768	hsa-miR-4514	CLIP-seq
MIRT1978769	hsa-miR-4692	CLIP-seq
MIRT1978770	hsa-miR-4742-5p	CLIP-seq
MIRT1978771	hsa-miR-499-3p	CLIP-seq
MIRT1978772	hsa-miR-499a-3p	CLIP-seq
MIRT1978773	hsa-miR-676	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
613945	24138	ENSG00000147570

Q9UF47

Protein name

DnaJ homolog subfamily C member 5B (Cysteine-string protein isoform beta) (CSP-beta)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00226	DnaJ	19 → 81	DnaJ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis specific.

Sequence

MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
ANEKTQLIKEGSRSYCTDS

Sequence length

199

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Coronary Disease	Coronary artery disease	Pubtator	22666496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	22666496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34580317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DNAJC5B (DnaJ heat shock protein family (Hsp40) member C5 beta)