Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	85409
Gene name	NKD inhibitor of Wnt signaling pathway 2
Gene symbol	NKD2
Synonyms (NCBI Gene)	Naked2
Chromosome	5
Chromosome location	5p15.33
Summary	This gene encodes a member of a family of proteins that function as negative regulators of Wnt receptor signaling through interaction with Dishevelled family members. The encoded protein participates in the delivery of transforming growth factor alpha-con

Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487601	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT487600	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT569090	hsa-miR-4780	PAR-CLIP	20371350
MIRT487599	hsa-miR-4635	PAR-CLIP	20371350
MIRT487598	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT487597	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT487596	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT487595	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT487593	hsa-miR-7843-3p	PAR-CLIP	20371350
MIRT487594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT496728	hsa-miR-4445-3p	PAR-CLIP	22291592
MIRT496727	hsa-miR-548al	PAR-CLIP	22291592
MIRT496726	hsa-miR-6809-5p	PAR-CLIP	22291592
MIRT496725	hsa-miR-197-3p	PAR-CLIP	22291592
MIRT487601	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT487600	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT487599	hsa-miR-4635	PAR-CLIP	23592263
MIRT487598	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT487597	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487596	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT487595	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT487593	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT487594	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT731588	hsa-miR-130b-3p	Luciferase reporter assay	26902120
MIRT731588	hsa-miR-130b-3p	Luciferase reporter assay	26902120
MIRT487601	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT487600	hsa-miR-1247-3p	PAR-CLIP	20371350
MIRT569090	hsa-miR-4780	PAR-CLIP	20371350
MIRT487599	hsa-miR-4635	PAR-CLIP	20371350
MIRT487598	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT487597	hsa-miR-3928-3p	PAR-CLIP	20371350
MIRT487596	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT487595	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT487593	hsa-miR-7843-3p	PAR-CLIP	20371350
MIRT487594	hsa-miR-127-5p	PAR-CLIP	20371350
MIRT496728	hsa-miR-4445-3p	PAR-CLIP	22291592
MIRT496727	hsa-miR-548al	PAR-CLIP	22291592
MIRT496726	hsa-miR-6809-5p	PAR-CLIP	22291592
MIRT496725	hsa-miR-197-3p	PAR-CLIP	22291592
MIRT487601	hsa-miR-5587-3p	PAR-CLIP	23592263
MIRT487600	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT487599	hsa-miR-4635	PAR-CLIP	23592263
MIRT487598	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT487597	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT487596	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT487595	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT487593	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT487594	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT1186225	hsa-miR-125a-5p	CLIP-seq
MIRT1186226	hsa-miR-125b	CLIP-seq
MIRT1186227	hsa-miR-146b-3p	CLIP-seq
MIRT1186228	hsa-miR-3124-5p	CLIP-seq
MIRT1186229	hsa-miR-3173-5p	CLIP-seq
MIRT1186230	hsa-miR-3928	CLIP-seq
MIRT1186231	hsa-miR-4319	CLIP-seq
MIRT1186232	hsa-miR-4675	CLIP-seq
MIRT1186233	hsa-miR-4741	CLIP-seq
MIRT1186234	hsa-miR-544b	CLIP-seq
MIRT1186235	hsa-miR-874	CLIP-seq
MIRT1551764	hsa-miR-3194-3p	CLIP-seq
MIRT1551765	hsa-miR-767-3p	CLIP-seq
MIRT1551764	hsa-miR-3194-3p	CLIP-seq
MIRT1186230	hsa-miR-3928	CLIP-seq
MIRT1551765	hsa-miR-767-3p	CLIP-seq
MIRT1186230	hsa-miR-3928	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15064403, 15687260, 18757723, 20177058, 21988832
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	18504258
GO:0005886	Component	Plasma membrane	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0010954	Process	Positive regulation of protein processing	IDA	15064403
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17553928
GO:0016328	Component	Lateral plasma membrane	IDA	20177058
GO:0019838	Function	Growth factor binding	IPI	15064403
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IBA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	15064403
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	18757723
GO:0032036	Function	Myosin heavy chain binding	IPI	18504258
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	20177058
GO:0046872	Function	Metal ion binding	IEA
GO:0048210	Process	Golgi vesicle fusion to target membrane	IMP	17553928
GO:0051117	Function	ATPase binding	IPI	18504258
GO:0060090	Function	Molecular adaptor activity	EXP	17045239
GO:0070382	Component	Exocytic vesicle	IDA	18504258
GO:0071944	Component	Cell periphery	IDA	15064403
GO:0072659	Process	Protein localization to plasma membrane	IMP	17553928
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	20177058
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	15687260
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	15064403

MIM	HGNC	e!Ensembl
607852	17046	ENSG00000145506

Q969F2

Protein name

Protein naked cuticle homolog 2 (Naked-2) (hNkd2)

Protein function

Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity (By similarity). Required for processing of TGFA and for targeting of TGFA to the basolateral membr

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, lung, pancreas and spleen. {ECO:0000269|PubMed:11604995}.

Sequence

MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFR
EDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEE
DDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPS
SKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDEN
TERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAV
LPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS

Sequence length

451

Interactions

View interactions

	KEGG
	Wnt signaling pathway Hippo signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	26124080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26985708, 27496341, 31204011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26396173, 26985708, 33455110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11604995, 27374455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11604995, 27374455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33357046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19847810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37059863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29126834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28056099	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26124080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11604995, 27374455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11604995, 26396173, 27374455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26124080, 26902120, 26985708, 27374455, 29126834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26902120, 27424978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27424978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16752383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11604995, 26396173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26396173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36348408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29678899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NKD2 (NKD inhibitor of Wnt signaling pathway 2)