RGS8 (regulator of G protein signaling 8)

Gene

• Entrez ID: 85397
• Gene name: Regulator of G protein signaling 8
• Gene symbol: RGS8
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q25.3
• Summary: This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. Th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018211	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	18434541
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	ISS
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	18434541
GO:0045202	Component	Synapse	IEA
GO:0060159	Process	Regulation of dopamine receptor signaling pathway	ISS

Other IDs

• MIM: 607189
• HGNC: 16810
• e!Ensembl: ENSG00000135824

Protein

• UniProt ID: P57771
• Protein name: Regulator of G-protein signaling 8 (RGS8)
• Protein function: Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2 (By similarity). Inhibits signal transduction by increasing the GTPase activity of G protein alph
• PDB: 2IHD, 2ODE, 5DO9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	56 → 171	Regulator of G protein signaling domain	Domain

• Sequence:

  MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
  LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
  VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
  

• Sequence length: 180

Pathways

Reactome:

G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	21135262		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	37550073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21135262		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	29758252		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21135262		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33845140	Associate	★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	11318611		★☆☆☆☆ Found in Text Mining only
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	BEFREE	11318611		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 2	Spinocerebellar Ataxia	BEFREE	25902068		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36059514	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin E Deficiency	Vitamin e deficiency	Pubtator	26446483	Associate	★☆☆☆☆ Found in Text Mining only