Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	85363
Gene name	Tripartite motif containing 5
Gene symbol	TRIM5
Synonyms (NCBI Gene)	RNF88TRIM5alpha
Chromosome	11
Chromosome location	11p15.4
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-co

257

Show/Hide all (257)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052397	hsa-let-7a-5p	CLASH	23622248
MIRT449416	hsa-miR-548u	PAR-CLIP	22100165
MIRT449414	hsa-miR-7161-5p	PAR-CLIP	22100165
MIRT449415	hsa-miR-8087	PAR-CLIP	22100165
MIRT449413	hsa-miR-4712-3p	PAR-CLIP	22100165
MIRT449412	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT449411	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT449410	hsa-miR-190b	PAR-CLIP	22100165
MIRT449409	hsa-miR-3689a-5p	PAR-CLIP	22100165
MIRT449408	hsa-miR-3689b-5p	PAR-CLIP	22100165
MIRT449407	hsa-miR-3689e	PAR-CLIP	22100165
MIRT449406	hsa-miR-3689f	PAR-CLIP	22100165
MIRT449404	hsa-miR-3161	PAR-CLIP	22100165
MIRT449405	hsa-miR-8070	PAR-CLIP	22100165
MIRT449403	hsa-miR-599	PAR-CLIP	22100165
MIRT439390	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439390	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT449416	hsa-miR-548u	PAR-CLIP	22100165
MIRT449414	hsa-miR-7161-5p	PAR-CLIP	22100165
MIRT449415	hsa-miR-8087	PAR-CLIP	22100165
MIRT449413	hsa-miR-4712-3p	PAR-CLIP	22100165
MIRT449412	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT449411	hsa-miR-190a-5p	PAR-CLIP	22100165
MIRT449410	hsa-miR-190b	PAR-CLIP	22100165
MIRT449409	hsa-miR-3689a-5p	PAR-CLIP	22100165
MIRT449408	hsa-miR-3689b-5p	PAR-CLIP	22100165
MIRT449407	hsa-miR-3689e	PAR-CLIP	22100165
MIRT449406	hsa-miR-3689f	PAR-CLIP	22100165
MIRT449404	hsa-miR-3161	PAR-CLIP	22100165
MIRT449405	hsa-miR-8070	PAR-CLIP	22100165
MIRT449403	hsa-miR-599	PAR-CLIP	22100165
MIRT1455123	hsa-miR-1252	CLIP-seq
MIRT1455124	hsa-miR-1267	CLIP-seq
MIRT1455125	hsa-miR-128	CLIP-seq
MIRT1455126	hsa-miR-27a	CLIP-seq
MIRT1455127	hsa-miR-27b	CLIP-seq
MIRT1455128	hsa-miR-3121-3p	CLIP-seq
MIRT1455129	hsa-miR-3671	CLIP-seq
MIRT1455130	hsa-miR-3682-3p	CLIP-seq
MIRT1455131	hsa-miR-4687-3p	CLIP-seq
MIRT1455132	hsa-miR-513a-5p	CLIP-seq
MIRT1455133	hsa-miR-567	CLIP-seq
MIRT1455134	hsa-miR-607	CLIP-seq
MIRT1455135	hsa-miR-653	CLIP-seq
MIRT1455136	hsa-miR-935	CLIP-seq
MIRT1455137	hsa-miR-1293	CLIP-seq
MIRT1455138	hsa-miR-24	CLIP-seq
MIRT1455139	hsa-miR-3122	CLIP-seq
MIRT1455140	hsa-miR-3178	CLIP-seq
MIRT1455141	hsa-miR-323-5p	CLIP-seq
MIRT1455142	hsa-miR-3647-3p	CLIP-seq
MIRT1455129	hsa-miR-3671	CLIP-seq
MIRT1455143	hsa-miR-3689a-3p	CLIP-seq
MIRT1455144	hsa-miR-3689c	CLIP-seq
MIRT1455145	hsa-miR-3913-5p	CLIP-seq
MIRT1455146	hsa-miR-4284	CLIP-seq
MIRT1455147	hsa-miR-4438	CLIP-seq
MIRT1455148	hsa-miR-4483	CLIP-seq
MIRT1455149	hsa-miR-4486	CLIP-seq
MIRT1455150	hsa-miR-4505	CLIP-seq
MIRT1455151	hsa-miR-4651	CLIP-seq
MIRT1455152	hsa-miR-4662a-5p	CLIP-seq
MIRT1455153	hsa-miR-4676-5p	CLIP-seq
MIRT1455154	hsa-miR-4728-5p	CLIP-seq
MIRT1455155	hsa-miR-541	CLIP-seq
MIRT1455156	hsa-miR-575	CLIP-seq
MIRT1455157	hsa-miR-592	CLIP-seq
MIRT1455158	hsa-miR-597	CLIP-seq
MIRT1455159	hsa-miR-608	CLIP-seq
MIRT1455160	hsa-miR-616	CLIP-seq
MIRT1455161	hsa-miR-654-5p	CLIP-seq
MIRT1455162	hsa-miR-876-3p	CLIP-seq
MIRT1455124	hsa-miR-1267	CLIP-seq
MIRT1455130	hsa-miR-3682-3p	CLIP-seq
MIRT2136390	hsa-miR-374a	CLIP-seq
MIRT2136391	hsa-miR-374b	CLIP-seq
MIRT2136392	hsa-miR-4521	CLIP-seq
MIRT1455131	hsa-miR-4687-3p	CLIP-seq
MIRT2136393	hsa-miR-642b	CLIP-seq
MIRT1455135	hsa-miR-653	CLIP-seq
MIRT2136394	hsa-miR-664	CLIP-seq
MIRT2136395	hsa-miR-944	CLIP-seq
MIRT2357271	hsa-let-7a	CLIP-seq
MIRT2357272	hsa-let-7b	CLIP-seq
MIRT2357273	hsa-let-7c	CLIP-seq
MIRT2357274	hsa-let-7d	CLIP-seq
MIRT2357275	hsa-let-7e	CLIP-seq
MIRT2357276	hsa-let-7f	CLIP-seq
MIRT2357277	hsa-let-7g	CLIP-seq
MIRT2357278	hsa-let-7i	CLIP-seq
MIRT1455124	hsa-miR-1267	CLIP-seq
MIRT2357279	hsa-miR-202	CLIP-seq
MIRT1455128	hsa-miR-3121-3p	CLIP-seq
MIRT2357280	hsa-miR-3165	CLIP-seq
MIRT2357281	hsa-miR-3622a-3p	CLIP-seq
MIRT2357282	hsa-miR-3622b-3p	CLIP-seq
MIRT2357283	hsa-miR-3656	CLIP-seq
MIRT2357284	hsa-miR-4257	CLIP-seq
MIRT2357285	hsa-miR-4305	CLIP-seq
MIRT2357286	hsa-miR-4458	CLIP-seq
MIRT2357287	hsa-miR-4500	CLIP-seq
MIRT2136392	hsa-miR-4521	CLIP-seq
MIRT1455131	hsa-miR-4687-3p	CLIP-seq
MIRT2357288	hsa-miR-4777-5p	CLIP-seq
MIRT2357289	hsa-miR-518d-5p	CLIP-seq
MIRT2357290	hsa-miR-519b-5p	CLIP-seq
MIRT2357291	hsa-miR-519c-5p	CLIP-seq
MIRT2357292	hsa-miR-520c-5p	CLIP-seq
MIRT2357293	hsa-miR-526a	CLIP-seq
MIRT2357294	hsa-miR-544b	CLIP-seq
MIRT2136393	hsa-miR-642b	CLIP-seq
MIRT1455135	hsa-miR-653	CLIP-seq
MIRT2136394	hsa-miR-664	CLIP-seq
MIRT2357295	hsa-miR-98	CLIP-seq
MIRT2357296	hsa-miR-4708-5p	CLIP-seq
MIRT2357297	hsa-miR-501-3p	CLIP-seq
MIRT2357298	hsa-miR-502-3p	CLIP-seq
MIRT2396365	hsa-miR-1273f	CLIP-seq
MIRT2396366	hsa-miR-143	CLIP-seq
MIRT2136392	hsa-miR-4521	CLIP-seq
MIRT2357296	hsa-miR-4708-5p	CLIP-seq
MIRT2396367	hsa-miR-4770	CLIP-seq
MIRT2136393	hsa-miR-642b	CLIP-seq
MIRT2136394	hsa-miR-664	CLIP-seq
MIRT1455139	hsa-miR-3122	CLIP-seq
MIRT2357280	hsa-miR-3165	CLIP-seq
MIRT2357281	hsa-miR-3622a-3p	CLIP-seq
MIRT2357282	hsa-miR-3622b-3p	CLIP-seq
MIRT2357283	hsa-miR-3656	CLIP-seq
MIRT1455143	hsa-miR-3689a-3p	CLIP-seq
MIRT1455144	hsa-miR-3689c	CLIP-seq
MIRT1455145	hsa-miR-3913-5p	CLIP-seq
MIRT1455154	hsa-miR-4728-5p	CLIP-seq
MIRT2357294	hsa-miR-544b	CLIP-seq
MIRT2651024	hsa-miR-1236	CLIP-seq
MIRT2651025	hsa-miR-1262	CLIP-seq
MIRT1455124	hsa-miR-1267	CLIP-seq
MIRT1455137	hsa-miR-1293	CLIP-seq
MIRT2651026	hsa-miR-146a	CLIP-seq
MIRT2651027	hsa-miR-146b-5p	CLIP-seq
MIRT2651028	hsa-miR-154	CLIP-seq
MIRT1455139	hsa-miR-3122	CLIP-seq
MIRT2651029	hsa-miR-3126-3p	CLIP-seq
MIRT2651030	hsa-miR-3128	CLIP-seq
MIRT2357280	hsa-miR-3165	CLIP-seq
MIRT2651031	hsa-miR-3183	CLIP-seq
MIRT1455141	hsa-miR-323-5p	CLIP-seq
MIRT2357281	hsa-miR-3622a-3p	CLIP-seq
MIRT2357282	hsa-miR-3622b-3p	CLIP-seq
MIRT1455142	hsa-miR-3647-3p	CLIP-seq
MIRT2357283	hsa-miR-3656	CLIP-seq
MIRT1455129	hsa-miR-3671	CLIP-seq
MIRT1455130	hsa-miR-3682-3p	CLIP-seq
MIRT1455143	hsa-miR-3689a-3p	CLIP-seq
MIRT1455144	hsa-miR-3689c	CLIP-seq
MIRT1455145	hsa-miR-3913-5p	CLIP-seq
MIRT2357284	hsa-miR-4257	CLIP-seq
MIRT2651032	hsa-miR-4302	CLIP-seq
MIRT2357285	hsa-miR-4305	CLIP-seq
MIRT1455148	hsa-miR-4483	CLIP-seq
MIRT2136392	hsa-miR-4521	CLIP-seq
MIRT1455151	hsa-miR-4651	CLIP-seq
MIRT2651033	hsa-miR-4659a-3p	CLIP-seq
MIRT2651034	hsa-miR-4659b-3p	CLIP-seq
MIRT1455152	hsa-miR-4662a-5p	CLIP-seq
MIRT2651035	hsa-miR-4668-3p	CLIP-seq
MIRT1455153	hsa-miR-4676-5p	CLIP-seq
MIRT1455131	hsa-miR-4687-3p	CLIP-seq
MIRT2651036	hsa-miR-4697-3p	CLIP-seq
MIRT2651037	hsa-miR-4698	CLIP-seq
MIRT2651038	hsa-miR-4701-3p	CLIP-seq
MIRT2651039	hsa-miR-4720-5p	CLIP-seq
MIRT2651040	hsa-miR-4723-3p	CLIP-seq
MIRT2651041	hsa-miR-4724-5p	CLIP-seq
MIRT1455154	hsa-miR-4728-5p	CLIP-seq
MIRT2357288	hsa-miR-4777-5p	CLIP-seq
MIRT2651042	hsa-miR-4778-3p	CLIP-seq
MIRT2651043	hsa-miR-4799-3p	CLIP-seq
MIRT2357289	hsa-miR-518d-5p	CLIP-seq
MIRT2357290	hsa-miR-519b-5p	CLIP-seq
MIRT2357291	hsa-miR-519c-5p	CLIP-seq
MIRT2357292	hsa-miR-520c-5p	CLIP-seq
MIRT2357293	hsa-miR-526a	CLIP-seq
MIRT1455155	hsa-miR-541	CLIP-seq
MIRT2357294	hsa-miR-544b	CLIP-seq
MIRT1455156	hsa-miR-575	CLIP-seq
MIRT2651044	hsa-miR-580	CLIP-seq
MIRT2651045	hsa-miR-589	CLIP-seq
MIRT1455157	hsa-miR-592	CLIP-seq
MIRT1455158	hsa-miR-597	CLIP-seq
MIRT1455134	hsa-miR-607	CLIP-seq
MIRT1455159	hsa-miR-608	CLIP-seq
MIRT1455160	hsa-miR-616	CLIP-seq
MIRT2136393	hsa-miR-642b	CLIP-seq
MIRT1455135	hsa-miR-653	CLIP-seq
MIRT1455161	hsa-miR-654-5p	CLIP-seq
MIRT2136394	hsa-miR-664	CLIP-seq
MIRT1455162	hsa-miR-876-3p	CLIP-seq
MIRT2651024	hsa-miR-1236	CLIP-seq
MIRT2651025	hsa-miR-1262	CLIP-seq
MIRT1455124	hsa-miR-1267	CLIP-seq
MIRT1455137	hsa-miR-1293	CLIP-seq
MIRT2651026	hsa-miR-146a	CLIP-seq
MIRT2651027	hsa-miR-146b-5p	CLIP-seq
MIRT1455139	hsa-miR-3122	CLIP-seq
MIRT2357280	hsa-miR-3165	CLIP-seq
MIRT2651031	hsa-miR-3183	CLIP-seq
MIRT1455141	hsa-miR-323-5p	CLIP-seq
MIRT2357281	hsa-miR-3622a-3p	CLIP-seq
MIRT2357282	hsa-miR-3622b-3p	CLIP-seq
MIRT1455142	hsa-miR-3647-3p	CLIP-seq
MIRT2357283	hsa-miR-3656	CLIP-seq
MIRT1455129	hsa-miR-3671	CLIP-seq
MIRT1455130	hsa-miR-3682-3p	CLIP-seq
MIRT1455143	hsa-miR-3689a-3p	CLIP-seq
MIRT1455144	hsa-miR-3689c	CLIP-seq
MIRT1455145	hsa-miR-3913-5p	CLIP-seq
MIRT2357284	hsa-miR-4257	CLIP-seq
MIRT2651032	hsa-miR-4302	CLIP-seq
MIRT2357285	hsa-miR-4305	CLIP-seq
MIRT1455148	hsa-miR-4483	CLIP-seq
MIRT2136392	hsa-miR-4521	CLIP-seq
MIRT1455151	hsa-miR-4651	CLIP-seq
MIRT2651033	hsa-miR-4659a-3p	CLIP-seq
MIRT2651034	hsa-miR-4659b-3p	CLIP-seq
MIRT1455152	hsa-miR-4662a-5p	CLIP-seq
MIRT2651035	hsa-miR-4668-3p	CLIP-seq
MIRT1455153	hsa-miR-4676-5p	CLIP-seq
MIRT1455131	hsa-miR-4687-3p	CLIP-seq
MIRT2651036	hsa-miR-4697-3p	CLIP-seq
MIRT2651037	hsa-miR-4698	CLIP-seq
MIRT2651038	hsa-miR-4701-3p	CLIP-seq
MIRT2651040	hsa-miR-4723-3p	CLIP-seq
MIRT2651041	hsa-miR-4724-5p	CLIP-seq
MIRT1455154	hsa-miR-4728-5p	CLIP-seq
MIRT2357288	hsa-miR-4777-5p	CLIP-seq
MIRT2651042	hsa-miR-4778-3p	CLIP-seq
MIRT2357289	hsa-miR-518d-5p	CLIP-seq
MIRT2357290	hsa-miR-519b-5p	CLIP-seq
MIRT2357291	hsa-miR-519c-5p	CLIP-seq
MIRT2357292	hsa-miR-520c-5p	CLIP-seq
MIRT2357293	hsa-miR-526a	CLIP-seq
MIRT1455155	hsa-miR-541	CLIP-seq
MIRT2357294	hsa-miR-544b	CLIP-seq
MIRT1455156	hsa-miR-575	CLIP-seq
MIRT2651044	hsa-miR-580	CLIP-seq
MIRT2651045	hsa-miR-589	CLIP-seq
MIRT1455157	hsa-miR-592	CLIP-seq
MIRT1455158	hsa-miR-597	CLIP-seq
MIRT1455134	hsa-miR-607	CLIP-seq
MIRT1455159	hsa-miR-608	CLIP-seq
MIRT1455160	hsa-miR-616	CLIP-seq
MIRT2136393	hsa-miR-642b	CLIP-seq
MIRT1455135	hsa-miR-653	CLIP-seq
MIRT1455161	hsa-miR-654-5p	CLIP-seq
MIRT2136394	hsa-miR-664	CLIP-seq
MIRT1455162	hsa-miR-876-3p	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	12878161, 20357094
GO:0002218	Process	Activation of innate immune response	IDA	21512573
GO:0002376	Process	Immune system process	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	21512573
GO:0005515	Function	Protein binding	IPI	12878161, 15919943, 20357094, 21512573, 22078707, 22493164, 25127057, 25203322, 26618866, 32296183, 32814053, 35156780
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11331580, 18248090, 25127057
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006914	Process	Autophagy	IDA	25127057
GO:0006914	Process	Autophagy	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	25127057
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	IMP	21512573
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IMP	25127057
GO:0038187	Function	Pattern recognition receptor activity	IDA	21512573
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	17156811, 22493164, 22829933
GO:0042803	Function	Protein homodimerization activity	IBA
GO:0042803	Function	Protein homodimerization activity	IPI	11331580
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	23077300
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	21512573
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	21512573
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046596	Process	Regulation of viral entry into host cell	IBA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21512573
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	TAS	21512573, 22291694
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	21512573
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:1990462	Component	Omegasome	IDA	25127057

MIM	HGNC	e!Ensembl
608487	16276	ENSG00000132256

Q9C035

Protein name

Tripartite motif-containing protein 5 (EC 2.3.2.27) (RING finger protein 88) (RING-type E3 ubiquitin transferase TRIM5)

Protein function

Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restr

PDB

2ECV , 2YRG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13445	zf-RING_UBOX	15 → 56	RING-type zinc-finger	Domain
PF00643	zf-B_box	90 → 131	B-box zinc finger	Domain
PF00622	SPRY	358 → 489	SPRY domain	Family

Sequence

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQ
GSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHY
WEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCGVPMTLCSPSS

Sequence length

493

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Human immunodeficiency virus 1 infection		Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACEREBRAL HEMORRHAGE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31312031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37264476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	27590274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37367937	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27590274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15709033, 16809279, 16840314, 20107597, 21734037, 22124667		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15249685, 16699044, 16887163, 17400754		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15249690, 15767395, 18166079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27590274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27590274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of anterior portion of floor of mouth	Malignant Neoplasm Of Anterior Portion Of Floor Of Mouth	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of floor of mouth	Malignant neoplasm of floor of mouth	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lateral floor of mouth	Malignant tumor of lateral floor of mouth	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of other sites within the lip and oral cavity	Malignant Neoplasm Of Lip And Oral Cavity	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of other specified parts of mouth	Malignant Neoplasm Of Mouth	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35545034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21311761, 30047100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21311761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24066097	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	28420387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pharyngeal Neoplasms	Pharyngeal Neoplasms	GWASCAT_DG	27749845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27244233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	27244233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	20107597		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM5 (tripartite motif containing 5)