Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8534
Gene name	Carbohydrate sulfotransferase 1
Gene symbol	CHST1
Synonyms (NCBI Gene)	C6STGST-1KS6STKSGal6STKSST
Chromosome	11
Chromosome location	11p11.2
Summary	This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments
MIRT892239	hsa-miR-4704-3p	CLIP-seq
MIRT1964400	hsa-miR-1207-5p	CLIP-seq
MIRT1964401	hsa-miR-1324	CLIP-seq
MIRT1964402	hsa-miR-197	CLIP-seq
MIRT1964403	hsa-miR-3180	CLIP-seq
MIRT1964404	hsa-miR-3180-3p	CLIP-seq
MIRT1964405	hsa-miR-3196	CLIP-seq
MIRT1964406	hsa-miR-4459	CLIP-seq
MIRT1964407	hsa-miR-4488	CLIP-seq
MIRT1964408	hsa-miR-4695-5p	CLIP-seq
MIRT1964409	hsa-miR-4697-5p	CLIP-seq
MIRT1964410	hsa-miR-4763-3p	CLIP-seq
MIRT1964411	hsa-miR-4790-3p	CLIP-seq
MIRT1964412	hsa-miR-940	CLIP-seq
MIRT2200560	hsa-miR-1247	CLIP-seq
MIRT2200561	hsa-miR-1271	CLIP-seq
MIRT2200562	hsa-miR-1281	CLIP-seq
MIRT2200563	hsa-miR-130a	CLIP-seq
MIRT2200564	hsa-miR-130b	CLIP-seq
MIRT1964401	hsa-miR-1324	CLIP-seq
MIRT2200565	hsa-miR-182	CLIP-seq
MIRT2200566	hsa-miR-19a	CLIP-seq
MIRT2200567	hsa-miR-19b	CLIP-seq
MIRT2200568	hsa-miR-301a	CLIP-seq
MIRT2200569	hsa-miR-301b	CLIP-seq
MIRT1964403	hsa-miR-3180	CLIP-seq
MIRT1964404	hsa-miR-3180-3p	CLIP-seq
MIRT1964405	hsa-miR-3196	CLIP-seq
MIRT2200570	hsa-miR-3666	CLIP-seq
MIRT2200571	hsa-miR-3919	CLIP-seq
MIRT2200572	hsa-miR-3942-3p	CLIP-seq
MIRT2200573	hsa-miR-4295	CLIP-seq
MIRT1964407	hsa-miR-4488	CLIP-seq
MIRT2200574	hsa-miR-454	CLIP-seq
MIRT2200575	hsa-miR-4671-3p	CLIP-seq
MIRT1964409	hsa-miR-4697-5p	CLIP-seq
MIRT892239	hsa-miR-4704-3p	CLIP-seq
MIRT2200576	hsa-miR-4756-3p	CLIP-seq
MIRT1964411	hsa-miR-4790-3p	CLIP-seq
MIRT2200577	hsa-miR-513a-3p	CLIP-seq
MIRT2200578	hsa-miR-96	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0005976	Process	Polysaccharide metabolic process	TAS	9405439
GO:0006012	Process	Galactose metabolic process	IDA	10330415
GO:0006044	Process	N-acetylglucosamine metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IDA	10330415
GO:0006790	Process	Sulfur compound metabolic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008146	Function	Sulfotransferase activity	IDA	10330415
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	9405439
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9405439
GO:0016020	Component	Membrane	TAS	9639683
GO:0016740	Function	Transferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	IDA	17690104
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0042339	Process	Keratan sulfate proteoglycan metabolic process	IBA
GO:0042339	Process	Keratan sulfate proteoglycan metabolic process	IDA	9405439
GO:0045130	Function	Keratan sulfotransferase activity	IBA
GO:0045130	Function	Keratan sulfotransferase activity	IDA	9405439, 17690104
GO:0045130	Function	Keratan sulfotransferase activity	IEA
GO:0045130	Function	Keratan sulfotransferase activity	TAS

MIM	HGNC	e!Ensembl
603797	1969	ENSG00000175264

O43916

Protein name

Carbohydrate sulfotransferase 1 (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1) (GST-1) (Keratan sulfate Gal-6 sulfotransferase) (KS6ST) (KSGal6ST) (KSST) (EC 2.8.2.21)

Protein function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of internal galactose (Gal) residues of keratan. Cooperates with B4GALT4 and B3GNT7 glycosyltransferases an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	60 → 384	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low level. Expressed in brain and skeletal muscle. Expressed by high endothelial cells (HEVs) and leukocytes. {ECO:0000269|PubMed:11310842, ECO:0000269|PubMed:9405439}.

Sequence

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRK
THILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGAS
RDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGD
CVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGIL
ASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV
RYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKW
RFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS

Sequence length

411

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - keratan sulfate		Keratan sulfate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anorexia Nervosa	Anorexia nervosa	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	9639683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32605588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	7781744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	LHGDN	18698629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15834859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35225482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST1 (carbohydrate sulfotransferase 1)