IFITM1 (interferon induced transmembrane protein 1)

Gene

• Entrez ID: 8519
• Gene name: Interferon induced transmembrane protein 1
• Gene symbol: IFITM1
• Synonyms (NCBI Gene): 9-27, CD225, DSPA2a, IFI17, LEU13
• Chromosome: 11
• Chromosome location: 11p15.5

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006992	hsa-miR-130a-3p	Luciferase reporter assay	22787204
MIRT018732	hsa-miR-335-5p	Microarray	18185580
MIRT021233	hsa-miR-146a-5p	Microarray	18057241
MIRT452119	hsa-miR-548av-3p	PAR-CLIP	23592263
MIRT452118	hsa-miR-548g-3p	PAR-CLIP	23592263
MIRT452117	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT452116	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT452115	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT452114	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT452113	hsa-miR-3650	PAR-CLIP	23592263
MIRT452112	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT452111	hsa-miR-6793-5p	PAR-CLIP	23592263
MIRT452110	hsa-miR-3911	PAR-CLIP	23592263
MIRT452109	hsa-miR-644a	PAR-CLIP	23592263
MIRT452108	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT452107	hsa-miR-6759-5p	PAR-CLIP	23592263
MIRT452106	hsa-miR-147a	PAR-CLIP	23592263
MIRT006992	hsa-miR-130a-3p	PAR-CLIP	27292025
MIRT755950	hsa-miR-363-3p	PAR-CLIP	27292025
MIRT452119	hsa-miR-548av-3p	PAR-CLIP	23592263
MIRT452118	hsa-miR-548g-3p	PAR-CLIP	23592263
MIRT452117	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT452116	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT452115	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT452114	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT452113	hsa-miR-3650	PAR-CLIP	23592263
MIRT452112	hsa-miR-6748-5p	PAR-CLIP	23592263
MIRT452111	hsa-miR-6793-5p	PAR-CLIP	23592263
MIRT452110	hsa-miR-3911	PAR-CLIP	23592263
MIRT452109	hsa-miR-644a	PAR-CLIP	23592263
MIRT452108	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT452107	hsa-miR-6759-5p	PAR-CLIP	23592263
MIRT452106	hsa-miR-147a	PAR-CLIP	23592263
MIRT755950	hsa-miR-363-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC)	37746648
MIRT1060540	hsa-miR-1183	CLIP-seq
MIRT1060541	hsa-miR-3117-5p	CLIP-seq
MIRT1060542	hsa-miR-425	CLIP-seq
MIRT1060543	hsa-miR-4325	CLIP-seq
MIRT1060540	hsa-miR-1183	CLIP-seq
MIRT2437699	hsa-miR-147	CLIP-seq
MIRT1060541	hsa-miR-3117-5p	CLIP-seq
MIRT2437700	hsa-miR-3934	CLIP-seq
MIRT2437701	hsa-miR-4718	CLIP-seq
MIRT2437702	hsa-miR-548g	CLIP-seq
MIRT2437703	hsa-miR-552	CLIP-seq
MIRT2437704	hsa-miR-644	CLIP-seq
MIRT1060540	hsa-miR-1183	CLIP-seq
MIRT2549807	hsa-miR-1207-5p	CLIP-seq
MIRT2549808	hsa-miR-122	CLIP-seq
MIRT2549809	hsa-miR-128	CLIP-seq
MIRT2549810	hsa-miR-1286	CLIP-seq
MIRT2549811	hsa-miR-130a	CLIP-seq
MIRT2549812	hsa-miR-130b	CLIP-seq
MIRT2437699	hsa-miR-147	CLIP-seq
MIRT2549813	hsa-miR-1909	CLIP-seq
MIRT2549814	hsa-miR-19a	CLIP-seq
MIRT2549815	hsa-miR-19b	CLIP-seq
MIRT2549816	hsa-miR-25	CLIP-seq
MIRT2549817	hsa-miR-301a	CLIP-seq
MIRT2549818	hsa-miR-301b	CLIP-seq
MIRT1060541	hsa-miR-3117-5p	CLIP-seq
MIRT2549819	hsa-miR-32	CLIP-seq
MIRT2549820	hsa-miR-338-3p	CLIP-seq
MIRT2549821	hsa-miR-363	CLIP-seq
MIRT2549822	hsa-miR-367	CLIP-seq
MIRT2549823	hsa-miR-3918	CLIP-seq
MIRT2437700	hsa-miR-3934	CLIP-seq
MIRT2549824	hsa-miR-4310	CLIP-seq
MIRT2549825	hsa-miR-4323	CLIP-seq
MIRT2549826	hsa-miR-454	CLIP-seq
MIRT2549827	hsa-miR-4640-5p	CLIP-seq
MIRT2549828	hsa-miR-4688	CLIP-seq
MIRT2437701	hsa-miR-4718	CLIP-seq
MIRT2549829	hsa-miR-4726-5p	CLIP-seq
MIRT2549830	hsa-miR-4763-3p	CLIP-seq
MIRT2549831	hsa-miR-486-3p	CLIP-seq
MIRT2437702	hsa-miR-548g	CLIP-seq
MIRT2437703	hsa-miR-552	CLIP-seq
MIRT2437704	hsa-miR-644	CLIP-seq
MIRT2549832	hsa-miR-92a	CLIP-seq
MIRT2549833	hsa-miR-92b	CLIP-seq
MIRT1060540	hsa-miR-1183	CLIP-seq
MIRT2549807	hsa-miR-1207-5p	CLIP-seq
MIRT2549808	hsa-miR-122	CLIP-seq
MIRT2549809	hsa-miR-128	CLIP-seq
MIRT2549810	hsa-miR-1286	CLIP-seq
MIRT2549811	hsa-miR-130a	CLIP-seq
MIRT2549812	hsa-miR-130b	CLIP-seq
MIRT2437699	hsa-miR-147	CLIP-seq
MIRT2549813	hsa-miR-1909	CLIP-seq
MIRT2549814	hsa-miR-19a	CLIP-seq
MIRT2549815	hsa-miR-19b	CLIP-seq
MIRT2549816	hsa-miR-25	CLIP-seq
MIRT2549817	hsa-miR-301a	CLIP-seq
MIRT2549818	hsa-miR-301b	CLIP-seq
MIRT1060541	hsa-miR-3117-5p	CLIP-seq
MIRT2549819	hsa-miR-32	CLIP-seq
MIRT2549820	hsa-miR-338-3p	CLIP-seq
MIRT2549821	hsa-miR-363	CLIP-seq
MIRT2549822	hsa-miR-367	CLIP-seq
MIRT2549823	hsa-miR-3918	CLIP-seq
MIRT2437700	hsa-miR-3934	CLIP-seq
MIRT2549824	hsa-miR-4310	CLIP-seq
MIRT2549825	hsa-miR-4323	CLIP-seq
MIRT2549826	hsa-miR-454	CLIP-seq
MIRT2549827	hsa-miR-4640-5p	CLIP-seq
MIRT2549828	hsa-miR-4688	CLIP-seq
MIRT2437701	hsa-miR-4718	CLIP-seq
MIRT2549829	hsa-miR-4726-5p	CLIP-seq
MIRT2549830	hsa-miR-4763-3p	CLIP-seq
MIRT2549831	hsa-miR-486-3p	CLIP-seq
MIRT2437702	hsa-miR-548g	CLIP-seq
MIRT2437703	hsa-miR-552	CLIP-seq
MIRT2437704	hsa-miR-644	CLIP-seq
MIRT2549832	hsa-miR-92a	CLIP-seq
MIRT2549833	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	2398277, 8409388, 26354436
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	26354436
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26354436
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7559564
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	7559564
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	20838853
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	7559564
GO:0009615	Process	Response to virus	IDA	21253575, 22479637
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	20838853
GO:0032991	Component	Protein-containing complex	IDA	28246125
GO:0034341	Process	Response to type II interferon	IBA
GO:0034341	Process	Response to type II interferon	IDA	21253575
GO:0035455	Process	Response to interferon-alpha	IBA
GO:0035455	Process	Response to interferon-alpha	IDA	22479637
GO:0035456	Process	Response to interferon-beta	IBA
GO:0035456	Process	Response to interferon-beta	IDA	21253575
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045071	Process	Negative regulation of viral genome replication	IDA	21253575
GO:0045071	Process	Negative regulation of viral genome replication	IMP	21976647
GO:0045087	Process	Innate immune response	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	22634173
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IBA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	21253575, 23358889, 26354436
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA

Other IDs

• MIM: 604456
• HGNC: 5412
• e!Ensembl: ENSG00000185885

Protein

• UniProt ID: P13164
• Protein name: Interferon-induced transmembrane protein 1 (Dispanin subfamily A member 2a) (DSPA2a) (Interferon-induced protein 17) (Interferon-inducible protein 9-27) (Leu-13 antigen) (CD antigen CD225)
• Protein function: IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, includi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04505	CD225	33 → 100	Interferon-induced transmembrane protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Bone (at protein level). Levels greatly elevated in colon cancer, cervical cancer, esophageal cancer and ovarian cancer. Expressed in glioma cell lines. {ECO:0000269|PubMed:20838853, ECO:0000269|PubMed:22634173}.
• Sequence:

  MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS
  VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ
  EKRGY

• Sequence length: 125

Pathways

KEGG:

B cell receptor signaling pathway

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Interferon alpha/beta signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	22609115, 29043607, 30318841		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31079850		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	20428811		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	29476661	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25588716, 28411130		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25588716, 30025446, 36766731, 39191497	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26884876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	27124937	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37209778, 37259059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28109085, 31205947		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29043607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24676393		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	28700435		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29051711		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29051711		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24120510	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20838853, 22490413, 26259513, 27852071		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19098285, 20838853, 26884876, 27852071	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22490413		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	35609018, 37259059	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	19011014	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	40619436	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24072182, 27124937	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	25288234, 28700435		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18202764		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19360286	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22631645	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39490745	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	28700435		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24072182	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20838853	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27221933	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	29770536		★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	37209778	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	26897526		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22609115	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37965330	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	24072182	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28700435		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	2265250	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2265250	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29286103	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29770536		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28212619	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20538795	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29043607	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25588716, 28411130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29043607		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28109085, 31205947		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29770536		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24676393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22609115		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22609115, 27852071, 30923336		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29051711		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28411130		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33753855, 34659201	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33168410	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27221933	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	29770536		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35283406	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22490413, 22609115, 28109085, 28411130, 29770536, 30318841, 30951861, 31205947, 31781559		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30318841		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24676393		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17012836	Stimulate	★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	20428811		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	35609018	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	24072182	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	18581327	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33769968, 34349764	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27221933, 30318841		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22631645		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21998657, 32865181, 34650128	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27221933	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22609115		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15808405		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22609115	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24120510		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30951861, 36008984	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28700435		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	BEFREE	28700435		★☆☆☆☆ Found in Text Mining only