Gene Gene information from NCBI Gene database.
Entrez ID 85015
Gene name Ubiquitin specific peptidase 45
Gene symbol USP45
Synonyms (NCBI Gene)
LCA19
Chromosome 6
Chromosome location 6q16.2
Summary The protein encoded by this gene is a deubiquitylase that binds ERCC1, the catalytic subunit of the XPF-ERCC1 DNA repair endonuclease. This endonuclease is a critical regulator of DNA repair processes, and the deubiquitylase activity of the encoded protei
miRNA miRNA information provided by mirtarbase database.
167
miRTarBase ID miRNA Experiments Reference
MIRT026646 hsa-miR-192-5p Microarray 19074876
MIRT028362 hsa-miR-32-5p Sequencing 20371350
MIRT051365 hsa-let-7f-5p CLASH 23622248
MIRT569069 hsa-miR-3662 PAR-CLIP 20371350
MIRT569068 hsa-miR-6873-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0001917 Component Photoreceptor inner segment IDA 30573563
GO:0001917 Component Photoreceptor inner segment IEA
GO:0003407 Process Neural retina development ISS
GO:0004843 Function Cysteine-type deubiquitinase activity IDA 14715245
GO:0004843 Function Cysteine-type deubiquitinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618439 20080 ENSG00000123552
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q70EL2
Protein name Ubiquitin carboxyl-terminal hydrolase 45 (EC 3.4.19.12) (Deubiquitinating enzyme 45) (Ubiquitin thioesterase 45) (Ubiquitin-specific-processing protease 45)
Protein function Catalyzes the deubiquitination of SPDL1 (PubMed:30258100). Plays a role in the repair of UV-induced DNA damage via deubiquitination of ERCC1, promoting its recruitment to DNA damage sites (PubMed:25538220). May be involved in the maintenance of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02148 zf-UBP 61 139 Zn-finger in ubiquitin-hydrolases and other protein Domain
PF00443 UCH 190 810 Ubiquitin carboxyl-terminal hydrolase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is detected in the cerebellum. In the eye, it is expressed at high levels in the optic nerve, sclera and retina, with relatively low levels in the choroid, lens and retinal pigment epithelium (PubMed:3
Sequence
MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINL
STWIIWCYECDEKLSTHCN
KKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQK
GGKCRNLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDP
LVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDFQQQDSQELLHY
LLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELTS
TVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIEN
IHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSES
RLNESPTDDSEKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSAG
KLLYTKETDSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSYSP
QNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEK
KVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSATCK
NASVGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHNTKKKNVPGLKAADNES
AGQWVHVSDTYLQVVPESRALSAQAYLLFY
ERVL
Sequence length 814
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex   Formation of Incision Complex in GG-NER
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
37
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Leber congenital amaurosis 19 Pathogenic rs202240410 RCV000790538
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Short stature Pathogenic; Likely pathogenic rs141844660, rs1562308994, rs1562391520, rs1562456317 RCV000736193
RCV000736192
RCV000736194
RCV000736195
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital cerebral hernia Congenital Cerebral Hernia HPO_DG
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Growth Disorders Growth disorder Pubtator 30809043 Associate
★☆☆☆☆
Found in Text Mining only
Hemiplegia/hemiparesis Hemiplegia/hemiparesis HPO_DG
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation HPO_DG
★☆☆☆☆
Found in Text Mining only
Keratoconus Keratoconus HPO_DG
★☆☆☆☆
Found in Text Mining only
Leber Congenital Amaurosis Leber Congenital Amaurosis BEFREE 30573563
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Leber Congenital Amaurosis Leber Congenital Amaurosis ORPHANET_DG 30573563
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Leber congenital amaurosis Leber Congenital Amaurosis Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations