Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8501
Gene name	Solute carrier family 43 member 1
Gene symbol	SLC43A1
Synonyms (NCBI Gene)	LAT3PB39POV1R00504
Chromosome	11
Chromosome location	11q12.1
Summary	SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIM, Mar 2008]

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046208	hsa-miR-27b-3p	CLASH	23622248
MIRT041721	hsa-miR-484	CLASH	23622248
MIRT725153	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT725152	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT725151	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT725150	hsa-miR-4676-5p	HITS-CLIP	19536157
MIRT725149	hsa-miR-575	HITS-CLIP	19536157
MIRT725148	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT725147	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT725146	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT725145	hsa-miR-623	HITS-CLIP	19536157
MIRT725144	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT725143	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT725142	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT725141	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT725140	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT725139	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT725138	hsa-miR-521	HITS-CLIP	19536157
MIRT725153	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT725152	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT725151	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT725150	hsa-miR-4676-5p	HITS-CLIP	19536157
MIRT725149	hsa-miR-575	HITS-CLIP	19536157
MIRT725148	hsa-miR-1226-3p	HITS-CLIP	19536157
MIRT725147	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT725146	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT725145	hsa-miR-623	HITS-CLIP	19536157
MIRT725144	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT725143	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT725142	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT725141	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT725140	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT725139	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT725138	hsa-miR-521	HITS-CLIP	19536157
MIRT1364153	hsa-miR-1238	CLIP-seq
MIRT1364154	hsa-miR-129-5p	CLIP-seq
MIRT1364155	hsa-miR-183	CLIP-seq
MIRT1364156	hsa-miR-3649	CLIP-seq
MIRT1364157	hsa-miR-450b-5p	CLIP-seq
MIRT1364158	hsa-miR-4691-5p	CLIP-seq
MIRT1364159	hsa-miR-4717-3p	CLIP-seq
MIRT1364160	hsa-miR-507	CLIP-seq
MIRT1364161	hsa-miR-557	CLIP-seq
MIRT1364162	hsa-miR-3675-5p	CLIP-seq
MIRT1364163	hsa-miR-483-3p	CLIP-seq
MIRT1364164	hsa-miR-486-3p	CLIP-seq
MIRT1364165	hsa-miR-659	CLIP-seq
MIRT1364154	hsa-miR-129-5p	CLIP-seq
MIRT2331859	hsa-miR-181a	CLIP-seq
MIRT2331860	hsa-miR-181b	CLIP-seq
MIRT2331861	hsa-miR-181c	CLIP-seq
MIRT2331862	hsa-miR-181d	CLIP-seq
MIRT2331863	hsa-miR-23a	CLIP-seq
MIRT2331864	hsa-miR-23b	CLIP-seq
MIRT2331865	hsa-miR-23c	CLIP-seq
MIRT2331866	hsa-miR-3121-3p	CLIP-seq
MIRT2331867	hsa-miR-342-3p	CLIP-seq
MIRT2331868	hsa-miR-4262	CLIP-seq
MIRT2331869	hsa-miR-4446-3p	CLIP-seq
MIRT1364157	hsa-miR-450b-5p	CLIP-seq
MIRT2331870	hsa-miR-4675	CLIP-seq
MIRT2331871	hsa-miR-4711-3p	CLIP-seq
MIRT2331872	hsa-miR-4721	CLIP-seq
MIRT2331873	hsa-miR-4741	CLIP-seq
MIRT1364160	hsa-miR-507	CLIP-seq
MIRT2331874	hsa-miR-520d-5p	CLIP-seq
MIRT2331875	hsa-miR-524-5p	CLIP-seq
MIRT1364161	hsa-miR-557	CLIP-seq
MIRT2331876	hsa-miR-593	CLIP-seq
MIRT2626385	hsa-miR-1827	CLIP-seq
MIRT2626386	hsa-miR-3612	CLIP-seq
MIRT2626387	hsa-miR-4459	CLIP-seq
MIRT2626388	hsa-miR-4695-5p	CLIP-seq
MIRT2626389	hsa-miR-650	CLIP-seq
MIRT2626390	hsa-miR-665	CLIP-seq
MIRT2691235	hsa-miR-1197	CLIP-seq
MIRT2691236	hsa-miR-1207-3p	CLIP-seq
MIRT2691237	hsa-miR-1266	CLIP-seq
MIRT2691238	hsa-miR-1273d	CLIP-seq
MIRT2626385	hsa-miR-1827	CLIP-seq
MIRT1364155	hsa-miR-183	CLIP-seq
MIRT2691239	hsa-miR-1972	CLIP-seq
MIRT2691240	hsa-miR-3124-3p	CLIP-seq
MIRT2626386	hsa-miR-3612	CLIP-seq
MIRT1364156	hsa-miR-3649	CLIP-seq
MIRT2691241	hsa-miR-4293	CLIP-seq
MIRT2691242	hsa-miR-4436a	CLIP-seq
MIRT2626387	hsa-miR-4459	CLIP-seq
MIRT2691243	hsa-miR-4518	CLIP-seq
MIRT2691244	hsa-miR-4643	CLIP-seq
MIRT2691245	hsa-miR-4650-5p	CLIP-seq
MIRT2626388	hsa-miR-4695-5p	CLIP-seq
MIRT1364159	hsa-miR-4717-3p	CLIP-seq
MIRT2691246	hsa-miR-596	CLIP-seq
MIRT2691247	hsa-miR-642b	CLIP-seq
MIRT2626389	hsa-miR-650	CLIP-seq
MIRT2626390	hsa-miR-665	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005304	Function	L-valine transmembrane transporter activity	IDA	12930836
GO:0005304	Function	L-valine transmembrane transporter activity	IEA
GO:0005304	Function	L-valine transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	12930836
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS
GO:0015171	Function	Amino acid transmembrane transporter activity	TAS
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IDA	12930836
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IEA
GO:0015188	Function	L-isoleucine transmembrane transporter activity	IDA	12930836
GO:0015188	Function	L-isoleucine transmembrane transporter activity	IEA
GO:0015188	Function	L-isoleucine transmembrane transporter activity	ISS
GO:0015190	Function	L-leucine transmembrane transporter activity	IDA	12930836
GO:0015190	Function	L-leucine transmembrane transporter activity	IEA
GO:0015190	Function	L-leucine transmembrane transporter activity	ISS
GO:0015804	Process	Neutral amino acid transport	IBA
GO:0015804	Process	Neutral amino acid transport	IDA	12930836
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015807	Process	L-amino acid transport	IEA
GO:0015818	Process	Isoleucine transport	IDA	12930836
GO:0015818	Process	Isoleucine transport	IEA
GO:0015818	Process	Isoleucine transport	ISS
GO:0015820	Process	L-leucine transport	IDA	12930836
GO:0015820	Process	L-leucine transport	IEA
GO:0015820	Process	L-leucine transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	19443642
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0051956	Process	Negative regulation of amino acid transport	IDA	26305885
GO:0055085	Process	Transmembrane transport	IEA
GO:0098846	Component	Podocyte foot	IDA	19443642
GO:1903785	Process	L-valine transmembrane transport	IDA	12930836
GO:1903785	Process	L-valine transmembrane transport	IEA
GO:1903785	Process	L-valine transmembrane transport	ISS
GO:1905533	Process	Negative regulation of L-leucine import across plasma membrane	IDA	26305885

MIM	HGNC	e!Ensembl
603733	9225	ENSG00000149150

O75387

Protein name

Large neutral amino acids transporter small subunit 3 (L-type amino acid transporter 3) (Prostate cancer overexpressed gene 1 protein) (Solute carrier family 43 member 1)

Protein function

Uniport that mediates the transport of neutral amino acids such as L-leucine, L-isoleucine, L-valine, and L-phenylalanine (PubMed:12930836). The transport activity is sodium ions-independent, electroneutral and mediated by a facilitated diffusio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	70 → 494	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in fetus and adult (PubMed:9722952). Highest expression in adult pancreas, liver, skeletal muscle (PubMed:12930836, PubMed:9722952). In fetus, highest expression in liver and lower levels in kidney, and lung (Pub

Sequence

MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQ
DEQRRWPGCDQQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTL
MALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAI
TFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLA
LDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFG
AMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLT
GLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQE
YAANGMGPLKVLSGSEVTA

Sequence length

559

Interactions

View interactions

	Reactome
			Amino acid transport across the plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34857913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24168110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29986096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11074541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22007000, 24052624, 31345230, 9722952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29986096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24052624, 9722952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22007000, 24052624, 31345230, 9722952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15342375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31345230, 34050700, 36344047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16115909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37800836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC43A1 (solute carrier family 43 member 1)