Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84986
Gene name	Rho GTPase activating protein 19
Gene symbol	ARHGAP19
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q24.1
Summary	Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases (see RHOA; MIM 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression (Lv et al., 2007 [P

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016589	hsa-miR-193b-3p	Microarray	20304954
MIRT024803	hsa-miR-215-5p	Microarray	19074876
MIRT026835	hsa-miR-192-5p	Microarray	19074876
MIRT035543	hsa-miR-24-3p	Luciferase reporter assay	23071155
MIRT035543	hsa-miR-24-3p	Luciferase reporter assay	23071155
MIRT051559	hsa-let-7e-5p	CLASH	23622248
MIRT047599	hsa-miR-10a-5p	CLASH	23622248
MIRT016589	hsa-miR-193b-3p	CLASH	23622248
MIRT040298	hsa-miR-615-3p	CLASH	23622248
MIRT722806	hsa-miR-3914	HITS-CLIP	19536157
MIRT722805	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT722804	hsa-miR-4762-5p	HITS-CLIP	19536157
MIRT722803	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT722802	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT026835	hsa-miR-192-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	33407571
MIRT722806	hsa-miR-3914	HITS-CLIP	19536157
MIRT722805	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT722804	hsa-miR-4762-5p	HITS-CLIP	19536157
MIRT722803	hsa-miR-6793-3p	HITS-CLIP	19536157
MIRT722802	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT793950	hsa-miR-1183	CLIP-seq
MIRT793951	hsa-miR-1228	CLIP-seq
MIRT793952	hsa-miR-1237	CLIP-seq
MIRT793953	hsa-miR-1245b-5p	CLIP-seq
MIRT793954	hsa-miR-1253	CLIP-seq
MIRT793955	hsa-miR-1273f	CLIP-seq
MIRT793956	hsa-miR-1276	CLIP-seq
MIRT793957	hsa-miR-1279	CLIP-seq
MIRT793958	hsa-miR-128	CLIP-seq
MIRT793959	hsa-miR-1294	CLIP-seq
MIRT793960	hsa-miR-1302	CLIP-seq
MIRT793961	hsa-miR-149	CLIP-seq
MIRT793962	hsa-miR-153	CLIP-seq
MIRT793963	hsa-miR-185	CLIP-seq
MIRT793964	hsa-miR-193a-3p	CLIP-seq
MIRT793965	hsa-miR-193b	CLIP-seq
MIRT793966	hsa-miR-200b	CLIP-seq
MIRT793967	hsa-miR-200c	CLIP-seq
MIRT793968	hsa-miR-2053	CLIP-seq
MIRT793969	hsa-miR-214	CLIP-seq
MIRT793970	hsa-miR-24	CLIP-seq
MIRT793971	hsa-miR-27a	CLIP-seq
MIRT793972	hsa-miR-27b	CLIP-seq
MIRT793973	hsa-miR-296-3p	CLIP-seq
MIRT793974	hsa-miR-3120-3p	CLIP-seq
MIRT793975	hsa-miR-3123	CLIP-seq
MIRT793976	hsa-miR-3124-3p	CLIP-seq
MIRT793977	hsa-miR-3126-5p	CLIP-seq
MIRT793978	hsa-miR-3140-3p	CLIP-seq
MIRT793979	hsa-miR-3142	CLIP-seq
MIRT793980	hsa-miR-3150b-3p	CLIP-seq
MIRT793981	hsa-miR-3153	CLIP-seq
MIRT793982	hsa-miR-3154	CLIP-seq
MIRT793983	hsa-miR-3163	CLIP-seq
MIRT793984	hsa-miR-3164	CLIP-seq
MIRT793985	hsa-miR-34a	CLIP-seq
MIRT793986	hsa-miR-34c-5p	CLIP-seq
MIRT793987	hsa-miR-3613-5p	CLIP-seq
MIRT793988	hsa-miR-3619-5p	CLIP-seq
MIRT793989	hsa-miR-3657	CLIP-seq
MIRT793990	hsa-miR-3660	CLIP-seq
MIRT793991	hsa-miR-3663-3p	CLIP-seq
MIRT793992	hsa-miR-3664-3p	CLIP-seq
MIRT793993	hsa-miR-3664-5p	CLIP-seq
MIRT793994	hsa-miR-371b-5p	CLIP-seq
MIRT793995	hsa-miR-377	CLIP-seq
MIRT793996	hsa-miR-421	CLIP-seq
MIRT793997	hsa-miR-4256	CLIP-seq
MIRT793998	hsa-miR-4284	CLIP-seq
MIRT793999	hsa-miR-429	CLIP-seq
MIRT794000	hsa-miR-4298	CLIP-seq
MIRT794001	hsa-miR-4306	CLIP-seq
MIRT794002	hsa-miR-4311	CLIP-seq
MIRT794003	hsa-miR-4312	CLIP-seq
MIRT794004	hsa-miR-4316	CLIP-seq
MIRT794005	hsa-miR-4419a	CLIP-seq
MIRT794006	hsa-miR-4427	CLIP-seq
MIRT794007	hsa-miR-4433	CLIP-seq
MIRT794008	hsa-miR-4438	CLIP-seq
MIRT794009	hsa-miR-4452	CLIP-seq
MIRT794010	hsa-miR-4459	CLIP-seq
MIRT794011	hsa-miR-4496	CLIP-seq
MIRT794012	hsa-miR-449a	CLIP-seq
MIRT794013	hsa-miR-449b	CLIP-seq
MIRT794014	hsa-miR-4504	CLIP-seq
MIRT794015	hsa-miR-4510	CLIP-seq
MIRT794016	hsa-miR-4526	CLIP-seq
MIRT794017	hsa-miR-4644	CLIP-seq
MIRT794018	hsa-miR-4661-3p	CLIP-seq
MIRT794019	hsa-miR-4669	CLIP-seq
MIRT794020	hsa-miR-4677-3p	CLIP-seq
MIRT794021	hsa-miR-4680-3p	CLIP-seq
MIRT794022	hsa-miR-4709-5p	CLIP-seq
MIRT794023	hsa-miR-4724-5p	CLIP-seq
MIRT794024	hsa-miR-4738-3p	CLIP-seq
MIRT794025	hsa-miR-4768-3p	CLIP-seq
MIRT794026	hsa-miR-4773	CLIP-seq
MIRT794027	hsa-miR-4784	CLIP-seq
MIRT794028	hsa-miR-502-5p	CLIP-seq
MIRT794029	hsa-miR-505	CLIP-seq
MIRT794030	hsa-miR-5095	CLIP-seq
MIRT794031	hsa-miR-5096	CLIP-seq
MIRT794032	hsa-miR-510	CLIP-seq
MIRT794033	hsa-miR-512-5p	CLIP-seq
MIRT794034	hsa-miR-520f	CLIP-seq
MIRT794035	hsa-miR-548ae	CLIP-seq
MIRT794036	hsa-miR-548aj	CLIP-seq
MIRT794037	hsa-miR-548am	CLIP-seq
MIRT794038	hsa-miR-548x	CLIP-seq
MIRT794039	hsa-miR-552	CLIP-seq
MIRT794040	hsa-miR-600	CLIP-seq
MIRT794041	hsa-miR-627	CLIP-seq
MIRT794042	hsa-miR-659	CLIP-seq
MIRT794043	hsa-miR-760	CLIP-seq
MIRT794044	hsa-miR-761	CLIP-seq
MIRT794045	hsa-miR-765	CLIP-seq
MIRT794046	hsa-miR-892b	CLIP-seq
MIRT793951	hsa-miR-1228	CLIP-seq
MIRT793969	hsa-miR-214	CLIP-seq
MIRT793974	hsa-miR-3120-3p	CLIP-seq
MIRT793988	hsa-miR-3619-5p	CLIP-seq
MIRT793995	hsa-miR-377	CLIP-seq
MIRT794047	hsa-miR-4272	CLIP-seq
MIRT794048	hsa-miR-4422	CLIP-seq
MIRT794049	hsa-miR-4668-5p	CLIP-seq
MIRT794031	hsa-miR-5096	CLIP-seq
MIRT794050	hsa-miR-570	CLIP-seq
MIRT794044	hsa-miR-761	CLIP-seq
MIRT1934301	hsa-miR-2115	CLIP-seq
MIRT1934302	hsa-miR-320e	CLIP-seq
MIRT1934303	hsa-miR-4698	CLIP-seq
MIRT1934301	hsa-miR-2115	CLIP-seq
MIRT1934304	hsa-miR-3117-5p	CLIP-seq
MIRT793974	hsa-miR-3120-3p	CLIP-seq
MIRT1934305	hsa-miR-369-5p	CLIP-seq
MIRT793995	hsa-miR-377	CLIP-seq
MIRT793996	hsa-miR-421	CLIP-seq
MIRT794018	hsa-miR-4661-3p	CLIP-seq
MIRT794022	hsa-miR-4709-5p	CLIP-seq
MIRT794029	hsa-miR-505	CLIP-seq
MIRT794030	hsa-miR-5095	CLIP-seq
MIRT1934306	hsa-miR-516a-3p	CLIP-seq
MIRT1934307	hsa-miR-545	CLIP-seq
MIRT1934308	hsa-miR-548p	CLIP-seq
MIRT794039	hsa-miR-552	CLIP-seq
MIRT794040	hsa-miR-600	CLIP-seq
MIRT2174133	hsa-miR-3908	CLIP-seq
MIRT2174134	hsa-miR-4291	CLIP-seq
MIRT2174135	hsa-miR-4476	CLIP-seq
MIRT1934307	hsa-miR-545	CLIP-seq
MIRT2174136	hsa-miR-579	CLIP-seq
MIRT2174137	hsa-miR-889	CLIP-seq
MIRT1934301	hsa-miR-2115	CLIP-seq
MIRT1934304	hsa-miR-3117-5p	CLIP-seq
MIRT1934305	hsa-miR-369-5p	CLIP-seq
MIRT794018	hsa-miR-4661-3p	CLIP-seq
MIRT794029	hsa-miR-505	CLIP-seq
MIRT794030	hsa-miR-5095	CLIP-seq
MIRT1934306	hsa-miR-516a-3p	CLIP-seq
MIRT794039	hsa-miR-552	CLIP-seq
MIRT794040	hsa-miR-600	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	16713569, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IBA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
611587	23724	ENSG00000213390

Q14CB8

Protein name

Rho GTPase-activating protein 19 (Rho-type GTPase-activating protein 19)

Protein function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	123 → 285	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Strong expression in fetal heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Weak expression in adult pancreas, spleen, thymus, and ovary. {ECO:0000269|PubMed:17454002}.

Sequence

MATEAQSEGEVPARESGRSDAICSFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEIFTEL
VVSNITRLIDLPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVIFGSPLTEE
GIAQIYQLIEYLHKNLRVEGLFRVPGNSVRQQILRDALNNGTDIDLESGEFHSNDVATLL
KMFLGELPEPLLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNR
NLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKNVTANDLQENITKLNSGMAFM
IKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCP
HQEETQHHTEEALRELFQHVHDMPESAKKKQLIRQFNKQSLTQTPGREPSTSQVQKRARS
RSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRL
KWSEGKKEGKKGFL

Sequence length

494

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Coronary Artery Disease	Coronary artery disease	Pubtator	35793981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22691236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP19 (Rho GTPase activating protein 19)