Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84985
Gene name	Family with sequence similarity 83 member A
Gene symbol	FAM83A
Synonyms (NCBI Gene)	BJ-TSA-9
Chromosome	8
Chromosome location	8q24.13

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT720705	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT720704	hsa-miR-6784-5p	HITS-CLIP	19536157
MIRT720703	hsa-miR-5090	HITS-CLIP	19536157
MIRT720702	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT720701	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT732744	hsa-miR-330-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunocytochemistry (ICC)	32010565
MIRT736759	hsa-miR-454-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR	32972302
MIRT720705	hsa-miR-6777-3p	HITS-CLIP	19536157
MIRT720704	hsa-miR-6784-5p	HITS-CLIP	19536157
MIRT720703	hsa-miR-5090	HITS-CLIP	19536157
MIRT720702	hsa-miR-6775-5p	HITS-CLIP	19536157
MIRT720701	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT756109	hsa-miR-454-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)Immunohistochemistry (IHC)Immunofluorescence	32972302
MIRT987635	hsa-miR-122	CLIP-seq
MIRT987636	hsa-miR-1279	CLIP-seq
MIRT987637	hsa-miR-1287	CLIP-seq
MIRT987638	hsa-miR-197	CLIP-seq
MIRT987639	hsa-miR-216a	CLIP-seq
MIRT987640	hsa-miR-3135b	CLIP-seq
MIRT987641	hsa-miR-3155	CLIP-seq
MIRT987642	hsa-miR-3155b	CLIP-seq
MIRT987643	hsa-miR-4294	CLIP-seq
MIRT987644	hsa-miR-431	CLIP-seq
MIRT987645	hsa-miR-4423-5p	CLIP-seq
MIRT987646	hsa-miR-4641	CLIP-seq
MIRT987647	hsa-miR-4677-3p	CLIP-seq
MIRT987648	hsa-miR-4679	CLIP-seq
MIRT987649	hsa-miR-483-5p	CLIP-seq
MIRT987650	hsa-miR-484	CLIP-seq
MIRT987651	hsa-miR-5096	CLIP-seq
MIRT987652	hsa-miR-924	CLIP-seq
MIRT738472	hsa-miR-1266	CLIP-seq
MIRT738475	hsa-miR-193a-5p	CLIP-seq
MIRT738474	hsa-miR-3664-3p	CLIP-seq
MIRT738469	hsa-miR-371b-3p	CLIP-seq
MIRT738470	hsa-miR-4270	CLIP-seq
MIRT738471	hsa-miR-4441	CLIP-seq
MIRT738473	hsa-miR-4518	CLIP-seq
MIRT738476	hsa-miR-9	CLIP-seq
MIRT738472	hsa-miR-1266	CLIP-seq
MIRT738475	hsa-miR-193a-5p	CLIP-seq
MIRT738474	hsa-miR-3664-3p	CLIP-seq
MIRT738469	hsa-miR-371b-3p	CLIP-seq
MIRT738470	hsa-miR-4270	CLIP-seq
MIRT738471	hsa-miR-4441	CLIP-seq
MIRT738473	hsa-miR-4518	CLIP-seq
MIRT738476	hsa-miR-9	CLIP-seq
MIRT1992666	hsa-miR-22	CLIP-seq
MIRT1992667	hsa-miR-324-5p	CLIP-seq
MIRT1992668	hsa-miR-3663-5p	CLIP-seq
MIRT1992669	hsa-miR-4292	CLIP-seq
MIRT1992670	hsa-miR-4308	CLIP-seq
MIRT1992671	hsa-miR-4488	CLIP-seq
MIRT1992672	hsa-miR-4511	CLIP-seq
MIRT1992673	hsa-miR-4697-5p	CLIP-seq
MIRT1992674	hsa-miR-582-3p	CLIP-seq
MIRT987635	hsa-miR-122	CLIP-seq
MIRT738472	hsa-miR-1266	CLIP-seq
MIRT987636	hsa-miR-1279	CLIP-seq
MIRT987637	hsa-miR-1287	CLIP-seq
MIRT738475	hsa-miR-193a-5p	CLIP-seq
MIRT987638	hsa-miR-197	CLIP-seq
MIRT987640	hsa-miR-3135b	CLIP-seq
MIRT2226661	hsa-miR-3149	CLIP-seq
MIRT987641	hsa-miR-3155	CLIP-seq
MIRT987642	hsa-miR-3155b	CLIP-seq
MIRT1992668	hsa-miR-3663-5p	CLIP-seq
MIRT738474	hsa-miR-3664-3p	CLIP-seq
MIRT738469	hsa-miR-371b-3p	CLIP-seq
MIRT2226662	hsa-miR-411	CLIP-seq
MIRT738470	hsa-miR-4270	CLIP-seq
MIRT987645	hsa-miR-4423-5p	CLIP-seq
MIRT738471	hsa-miR-4441	CLIP-seq
MIRT738473	hsa-miR-4518	CLIP-seq
MIRT987646	hsa-miR-4641	CLIP-seq
MIRT987649	hsa-miR-483-5p	CLIP-seq
MIRT987650	hsa-miR-484	CLIP-seq
MIRT987651	hsa-miR-5096	CLIP-seq
MIRT738476	hsa-miR-9	CLIP-seq
MIRT738472	hsa-miR-1266	CLIP-seq
MIRT738475	hsa-miR-193a-5p	CLIP-seq
MIRT738474	hsa-miR-3664-3p	CLIP-seq
MIRT738469	hsa-miR-371b-3p	CLIP-seq
MIRT738470	hsa-miR-4270	CLIP-seq
MIRT738471	hsa-miR-4441	CLIP-seq
MIRT738473	hsa-miR-4518	CLIP-seq
MIRT2387869	hsa-miR-515-3p	CLIP-seq
MIRT2387870	hsa-miR-519e	CLIP-seq
MIRT738476	hsa-miR-9	CLIP-seq
MIRT2530632	hsa-miR-1343	CLIP-seq
MIRT2530633	hsa-miR-2115	CLIP-seq
MIRT2530634	hsa-miR-498	CLIP-seq
MIRT2530635	hsa-miR-516a-3p	CLIP-seq
MIRT2530632	hsa-miR-1343	CLIP-seq
MIRT2530633	hsa-miR-2115	CLIP-seq
MIRT2530634	hsa-miR-498	CLIP-seq
MIRT2530635	hsa-miR-516a-3p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 29789297, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	22886303
GO:0008283	Process	Cell population proliferation	IMP	22886303
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IDA	22886303
GO:0019901	Function	Protein kinase binding	IPI	22886303, 24736947
GO:0036312	Function	Phosphatidylinositol 3-kinase regulatory subunit binding	IDA	22886303
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050872	Process	White fat cell differentiation	ISS
GO:1904179	Process	Positive regulation of adipose tissue development	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	ISS

MIM	HGNC	e!Ensembl
621022	28210	ENSG00000147689

Q86UY5

Protein name

Protein FAM83A (Tumor antigen BJ-TSA-9) (Tumor-specific gene expressed in prostate protein)

Protein function

Involved in mitochondrial maintenance during adipogenesis. May be acting by playing a role in the maintenance of normal mitochondrial function.

PDB

4URJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07894	FAM83	19 → 295	FAM83 A-H	Family

Sequence

MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEV
DFLSSVEAQYIQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHS
WASAEKPYLKEKSSATVYFQTVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILE
AANKRGVFVCVLLDQGGVKLFQEMCDKVQISDSHLKNISIRSVEGEIYCAKSGRKFAGQI
REKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVELFDEEFRHLYASSKPVMGLK
SPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVSASSGPCSPAA
PHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL
TPTWRPFLQASPHF

Sequence length

434

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26081616, 31527715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16354590, 31065463, 31175804, 31594212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	33747255	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22886303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28463969, 35139887, 35650627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30696738, 37065746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31696213	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16354590, 31594212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33015782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37081097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31696213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16354590, 18514066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16354590, 31594212, 33266425, 35422093, 35635086, 36960858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30659636, 31696213, 35164653	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33015782	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22886303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16354590, 31594212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28287611, 31527715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22886303, 28287611, 31444970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16354590, 28078827, 28463969, 31594212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29201200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30659636, 31083571, 31444970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28641578	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28287611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34290570, 37065746, 37245082, 37260110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM83A (family with sequence similarity 83 member A)