Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84962
Gene name	Ajuba LIM protein
Gene symbol	AJUBA
Synonyms (NCBI Gene)	JUB
Chromosome	14
Chromosome location	14q11.2

Show/Hide all (5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021880	hsa-miR-128-3p	Microarray	17612493
MIRT025601	hsa-miR-10a-5p	Sequencing	20371350
MIRT042680	hsa-miR-196b-5p	CLASH	23622248
MIRT736613	hsa-miR-1184	Western blottingImmunoprecipitaion (IP)qRT-PCR	32681581
MIRT756224	hsa-miR-21-5p	Luciferase reporter assayWestern blottingqRT-PCR	36457985

Show/Hide all (59)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000932	Component	P-body	IBA
GO:0000932	Component	P-body	IDA	20616046
GO:0000932	Component	P-body	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IDA	22286099
GO:0001666	Process	Response to hypoxia	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	18805794
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	15778465, 16413547, 18331720, 18805794, 20303269, 20616046, 22286099, 25314079, 32296183, 33961781, 37219487
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18805794
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IDA	12417594
GO:0005911	Component	Cell-cell junction	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0009891	Process	Positive regulation of biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030295	Function	Protein kinase activator activity	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	15870274
GO:0035195	Process	MiRNA-mediated post-transcriptional gene silencing	IMP	20616046
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IEA
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IMP	20616046
GO:0035313	Process	Wound healing, spreading of epidermal cells	IEA
GO:0035331	Process	Negative regulation of hippo signaling	IBA
GO:0035331	Process	Negative regulation of hippo signaling	IDA	20303269
GO:0035331	Process	Negative regulation of hippo signaling	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0045294	Function	Alpha-catenin binding	IDA	12417594
GO:0045294	Function	Alpha-catenin binding	IEA
GO:0046474	Process	Glycerophospholipid biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:1900037	Process	Regulation of cellular response to hypoxia	IDA	22286099

MIM	HGNC	e!Ensembl
609066	20250	ENSG00000129474

Q96IF1

Protein name

LIM domain-containing protein ajuba

Protein function

Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, mitosis, cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	338 → 394	LIM domain	Domain
PF00412	LIM	403 → 459	LIM domain	Domain
PF00412	LIM	463 → 528	LIM domain	Domain

Sequence

MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI

Sequence length

538

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway Hippo signaling pathway - multiple species		Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Regulation of PLK1 Activity at G2/M Transition

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	31101117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30597111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35178446	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29126926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29126926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24673742, 27893714, 30410349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24673742	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34173718, 36267311, 36931700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29127303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25839328	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	26406867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26406867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26406867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35178446	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24336325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28422308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27172796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29126926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24023255, 24673742, 26406867, 27893714, 28126323, 28422308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	24336325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29596435, 31101117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28422308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23714854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	23714854, 27627196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	25151357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25839328, 27172796, 29127303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29053175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28126323, 29053175		★★★★★ ★☆☆☆☆ Found in Text Mining only

AJUBA (ajuba LIM protein)