Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84959
Gene name	Ubiquitin associated and SH3 domain containing B
Gene symbol	UBASH3B
Synonyms (NCBI Gene)	STS-1STS1TULA-2TULA2p70
Chromosome	11
Chromosome location	11q24.1
Summary	This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of

237

Show/Hide all (237)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024758	hsa-miR-215-5p	Microarray	19074876
MIRT026942	hsa-miR-192-5p	Microarray	19074876
MIRT053353	hsa-miR-200a-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23784775
MIRT492023	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT492022	hsa-miR-486-5p	PAR-CLIP	23592263
MIRT492021	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT492020	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT443795	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT443794	hsa-miR-3662	PAR-CLIP	22100165
MIRT443793	hsa-miR-586	PAR-CLIP	22100165
MIRT443792	hsa-miR-4275	PAR-CLIP	22100165
MIRT443791	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443790	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443789	hsa-miR-491-3p	PAR-CLIP	22100165
MIRT492023	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT492022	hsa-miR-486-5p	PAR-CLIP	23592263
MIRT492021	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT492020	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT443795	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT443794	hsa-miR-3662	PAR-CLIP	22100165
MIRT443793	hsa-miR-586	PAR-CLIP	22100165
MIRT443792	hsa-miR-4275	PAR-CLIP	22100165
MIRT443791	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443790	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443789	hsa-miR-491-3p	PAR-CLIP	22100165
MIRT1466855	hsa-miR-1225-3p	CLIP-seq
MIRT1466856	hsa-miR-1227	CLIP-seq
MIRT1466857	hsa-miR-1228	CLIP-seq
MIRT1466858	hsa-miR-1233	CLIP-seq
MIRT1466859	hsa-miR-1237	CLIP-seq
MIRT1466860	hsa-miR-1245b-5p	CLIP-seq
MIRT1466861	hsa-miR-1248	CLIP-seq
MIRT1466862	hsa-miR-219-5p	CLIP-seq
MIRT1466863	hsa-miR-24	CLIP-seq
MIRT1466864	hsa-miR-27a	CLIP-seq
MIRT1466865	hsa-miR-27b	CLIP-seq
MIRT1466866	hsa-miR-3124-3p	CLIP-seq
MIRT1466867	hsa-miR-3142	CLIP-seq
MIRT1466868	hsa-miR-3145-5p	CLIP-seq
MIRT1466869	hsa-miR-3157-5p	CLIP-seq
MIRT1466870	hsa-miR-3187-3p	CLIP-seq
MIRT1466871	hsa-miR-342-3p	CLIP-seq
MIRT1466872	hsa-miR-3682-3p	CLIP-seq
MIRT1466873	hsa-miR-3934	CLIP-seq
MIRT1466874	hsa-miR-3942-3p	CLIP-seq
MIRT1466875	hsa-miR-4284	CLIP-seq
MIRT1466876	hsa-miR-4433	CLIP-seq
MIRT1466877	hsa-miR-4445	CLIP-seq
MIRT1466878	hsa-miR-4459	CLIP-seq
MIRT1466879	hsa-miR-4502	CLIP-seq
MIRT1466880	hsa-miR-4529-5p	CLIP-seq
MIRT1466881	hsa-miR-4640-5p	CLIP-seq
MIRT1466882	hsa-miR-4688	CLIP-seq
MIRT1466883	hsa-miR-4691-3p	CLIP-seq
MIRT1466884	hsa-miR-4722-5p	CLIP-seq
MIRT1466885	hsa-miR-4726-5p	CLIP-seq
MIRT1466886	hsa-miR-4782-3p	CLIP-seq
MIRT1466887	hsa-miR-486-3p	CLIP-seq
MIRT1466888	hsa-miR-500a	CLIP-seq
MIRT1466889	hsa-miR-508-3p	CLIP-seq
MIRT1466890	hsa-miR-513a-5p	CLIP-seq
MIRT1466891	hsa-miR-595	CLIP-seq
MIRT1466892	hsa-miR-603	CLIP-seq
MIRT1466893	hsa-miR-659	CLIP-seq
MIRT1466894	hsa-miR-665	CLIP-seq
MIRT1466895	hsa-miR-885-3p	CLIP-seq
MIRT1466855	hsa-miR-1225-3p	CLIP-seq
MIRT1466858	hsa-miR-1233	CLIP-seq
MIRT2140320	hsa-miR-1257	CLIP-seq
MIRT2140321	hsa-miR-141	CLIP-seq
MIRT2140322	hsa-miR-200a	CLIP-seq
MIRT1466869	hsa-miR-3157-5p	CLIP-seq
MIRT1466870	hsa-miR-3187-3p	CLIP-seq
MIRT1466871	hsa-miR-342-3p	CLIP-seq
MIRT2140323	hsa-miR-3667-3p	CLIP-seq
MIRT2140324	hsa-miR-3681	CLIP-seq
MIRT1466874	hsa-miR-3942-3p	CLIP-seq
MIRT1466876	hsa-miR-4433	CLIP-seq
MIRT1466878	hsa-miR-4459	CLIP-seq
MIRT2140325	hsa-miR-4495	CLIP-seq
MIRT1466880	hsa-miR-4529-5p	CLIP-seq
MIRT1466882	hsa-miR-4688	CLIP-seq
MIRT1466883	hsa-miR-4691-3p	CLIP-seq
MIRT1466884	hsa-miR-4722-5p	CLIP-seq
MIRT1466887	hsa-miR-486-3p	CLIP-seq
MIRT1466894	hsa-miR-665	CLIP-seq
MIRT1466857	hsa-miR-1228	CLIP-seq
MIRT2361053	hsa-miR-1256	CLIP-seq
MIRT2140320	hsa-miR-1257	CLIP-seq
MIRT1466864	hsa-miR-27a	CLIP-seq
MIRT1466865	hsa-miR-27b	CLIP-seq
MIRT2361054	hsa-miR-3122	CLIP-seq
MIRT2361055	hsa-miR-3155	CLIP-seq
MIRT2361056	hsa-miR-3155b	CLIP-seq
MIRT2361057	hsa-miR-3160-5p	CLIP-seq
MIRT2361058	hsa-miR-3689a-3p	CLIP-seq
MIRT2361059	hsa-miR-3689c	CLIP-seq
MIRT2361060	hsa-miR-3913-5p	CLIP-seq
MIRT1466874	hsa-miR-3942-3p	CLIP-seq
MIRT2361061	hsa-miR-4452	CLIP-seq
MIRT2361062	hsa-miR-4471	CLIP-seq
MIRT2361063	hsa-miR-450b-5p	CLIP-seq
MIRT1466882	hsa-miR-4688	CLIP-seq
MIRT2361064	hsa-miR-4720-5p	CLIP-seq
MIRT2361065	hsa-miR-4753-3p	CLIP-seq
MIRT2361066	hsa-miR-4799-3p	CLIP-seq
MIRT2361067	hsa-miR-484	CLIP-seq
MIRT1466887	hsa-miR-486-3p	CLIP-seq
MIRT1466888	hsa-miR-500a	CLIP-seq
MIRT1466890	hsa-miR-513a-5p	CLIP-seq
MIRT2361068	hsa-miR-518a-5p	CLIP-seq
MIRT2361069	hsa-miR-527	CLIP-seq
MIRT2361070	hsa-miR-584	CLIP-seq
MIRT2361071	hsa-miR-593	CLIP-seq
MIRT2396576	hsa-miR-4774-5p	CLIP-seq
MIRT2441575	hsa-miR-3140-5p	CLIP-seq
MIRT2441576	hsa-miR-3622a-3p	CLIP-seq
MIRT2441577	hsa-miR-3622b-3p	CLIP-seq
MIRT2441578	hsa-miR-3692	CLIP-seq
MIRT2441579	hsa-miR-4680-3p	CLIP-seq
MIRT2441580	hsa-miR-578	CLIP-seq
MIRT2441581	hsa-miR-944	CLIP-seq
MIRT2462737	hsa-miR-106a	CLIP-seq
MIRT2462738	hsa-miR-106b	CLIP-seq
MIRT2462739	hsa-miR-10a	CLIP-seq
MIRT2462740	hsa-miR-10b	CLIP-seq
MIRT2462741	hsa-miR-1270	CLIP-seq
MIRT2462742	hsa-miR-17	CLIP-seq
MIRT2462743	hsa-miR-185	CLIP-seq
MIRT2462744	hsa-miR-20a	CLIP-seq
MIRT2462745	hsa-miR-20b	CLIP-seq
MIRT2462746	hsa-miR-302a	CLIP-seq
MIRT2462747	hsa-miR-302b	CLIP-seq
MIRT2462748	hsa-miR-302c	CLIP-seq
MIRT2462749	hsa-miR-302d	CLIP-seq
MIRT2462750	hsa-miR-302e	CLIP-seq
MIRT2462751	hsa-miR-339-5p	CLIP-seq
MIRT2462752	hsa-miR-372	CLIP-seq
MIRT2462753	hsa-miR-373	CLIP-seq
MIRT2462754	hsa-miR-4306	CLIP-seq
MIRT2462755	hsa-miR-4421	CLIP-seq
MIRT2462756	hsa-miR-4531	CLIP-seq
MIRT2462757	hsa-miR-4644	CLIP-seq
MIRT2462758	hsa-miR-4725-5p	CLIP-seq
MIRT2462759	hsa-miR-4786-5p	CLIP-seq
MIRT2462760	hsa-miR-504	CLIP-seq
MIRT2462761	hsa-miR-519d	CLIP-seq
MIRT2462762	hsa-miR-520a-3p	CLIP-seq
MIRT2462763	hsa-miR-520b	CLIP-seq
MIRT2462764	hsa-miR-520c-3p	CLIP-seq
MIRT2462765	hsa-miR-520d-3p	CLIP-seq
MIRT2462766	hsa-miR-520e	CLIP-seq
MIRT2462767	hsa-miR-520f	CLIP-seq
MIRT2462768	hsa-miR-548ac	CLIP-seq
MIRT2462769	hsa-miR-548ae	CLIP-seq
MIRT2462770	hsa-miR-548aj	CLIP-seq
MIRT2462771	hsa-miR-548am	CLIP-seq
MIRT2462772	hsa-miR-548d-3p	CLIP-seq
MIRT2462773	hsa-miR-548p	CLIP-seq
MIRT2462774	hsa-miR-548t	CLIP-seq
MIRT2462775	hsa-miR-548x	CLIP-seq
MIRT2462776	hsa-miR-548z	CLIP-seq
MIRT2361071	hsa-miR-593	CLIP-seq
MIRT2462777	hsa-miR-620	CLIP-seq
MIRT2462778	hsa-miR-769-5p	CLIP-seq
MIRT2462779	hsa-miR-93	CLIP-seq
MIRT2462739	hsa-miR-10a	CLIP-seq
MIRT2462740	hsa-miR-10b	CLIP-seq
MIRT1466855	hsa-miR-1225-3p	CLIP-seq
MIRT1466858	hsa-miR-1233	CLIP-seq
MIRT2462751	hsa-miR-339-5p	CLIP-seq
MIRT2462755	hsa-miR-4421	CLIP-seq
MIRT1466876	hsa-miR-4433	CLIP-seq
MIRT1466878	hsa-miR-4459	CLIP-seq
MIRT1466882	hsa-miR-4688	CLIP-seq
MIRT1466884	hsa-miR-4722-5p	CLIP-seq
MIRT2462758	hsa-miR-4725-5p	CLIP-seq
MIRT2462759	hsa-miR-4786-5p	CLIP-seq
MIRT1466887	hsa-miR-486-3p	CLIP-seq
MIRT2462760	hsa-miR-504	CLIP-seq
MIRT2462768	hsa-miR-548ac	CLIP-seq
MIRT2462769	hsa-miR-548ae	CLIP-seq
MIRT2462770	hsa-miR-548aj	CLIP-seq
MIRT2462771	hsa-miR-548am	CLIP-seq
MIRT2462772	hsa-miR-548d-3p	CLIP-seq
MIRT2462775	hsa-miR-548x	CLIP-seq
MIRT2462776	hsa-miR-548z	CLIP-seq
MIRT2361071	hsa-miR-593	CLIP-seq
MIRT1466894	hsa-miR-665	CLIP-seq
MIRT2462778	hsa-miR-769-5p	CLIP-seq
MIRT2462739	hsa-miR-10a	CLIP-seq
MIRT2462740	hsa-miR-10b	CLIP-seq
MIRT2694585	hsa-miR-1183	CLIP-seq
MIRT1466855	hsa-miR-1225-3p	CLIP-seq
MIRT1466858	hsa-miR-1233	CLIP-seq
MIRT2694586	hsa-miR-1271	CLIP-seq
MIRT2694587	hsa-miR-1279	CLIP-seq
MIRT2694588	hsa-miR-182	CLIP-seq
MIRT2694589	hsa-miR-186	CLIP-seq
MIRT2694590	hsa-miR-25	CLIP-seq
MIRT2694591	hsa-miR-3177-5p	CLIP-seq
MIRT2694592	hsa-miR-32	CLIP-seq
MIRT2462751	hsa-miR-339-5p	CLIP-seq
MIRT2694593	hsa-miR-363	CLIP-seq
MIRT2694594	hsa-miR-367	CLIP-seq
MIRT2462755	hsa-miR-4421	CLIP-seq
MIRT1466876	hsa-miR-4433	CLIP-seq
MIRT1466878	hsa-miR-4459	CLIP-seq
MIRT2694595	hsa-miR-4462	CLIP-seq
MIRT2361063	hsa-miR-450b-5p	CLIP-seq
MIRT1466882	hsa-miR-4688	CLIP-seq
MIRT1466884	hsa-miR-4722-5p	CLIP-seq
MIRT2462758	hsa-miR-4725-5p	CLIP-seq
MIRT2462759	hsa-miR-4786-5p	CLIP-seq
MIRT2694596	hsa-miR-4803	CLIP-seq
MIRT1466887	hsa-miR-486-3p	CLIP-seq
MIRT2462760	hsa-miR-504	CLIP-seq
MIRT2361068	hsa-miR-518a-5p	CLIP-seq
MIRT2694597	hsa-miR-520d-5p	CLIP-seq
MIRT2694598	hsa-miR-524-5p	CLIP-seq
MIRT2361069	hsa-miR-527	CLIP-seq
MIRT2462768	hsa-miR-548ac	CLIP-seq
MIRT2462769	hsa-miR-548ae	CLIP-seq
MIRT2462770	hsa-miR-548aj	CLIP-seq
MIRT2462771	hsa-miR-548am	CLIP-seq
MIRT2462772	hsa-miR-548d-3p	CLIP-seq
MIRT2462775	hsa-miR-548x	CLIP-seq
MIRT2462776	hsa-miR-548z	CLIP-seq
MIRT2694599	hsa-miR-552	CLIP-seq
MIRT2361070	hsa-miR-584	CLIP-seq
MIRT2361071	hsa-miR-593	CLIP-seq
MIRT1466891	hsa-miR-595	CLIP-seq
MIRT1466894	hsa-miR-665	CLIP-seq
MIRT2462778	hsa-miR-769-5p	CLIP-seq
MIRT2694600	hsa-miR-92a	CLIP-seq
MIRT2694601	hsa-miR-92b	CLIP-seq
MIRT2694602	hsa-miR-96	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	17599067, 20585042, 24722188, 25416956, 28514442, 31515488, 32296183, 33961781, 36179048
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0009968	Process	Negative regulation of signal transduction	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IBA
GO:0038063	Process	Collagen-activated tyrosine kinase receptor signaling pathway	IEA
GO:0038065	Process	Collagen-activated signaling pathway	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045670	Process	Regulation of osteoclast differentiation	IBA
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045779	Process	Negative regulation of bone resorption	IBA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IBA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0070527	Process	Platelet aggregation	IBA
GO:0070527	Process	Platelet aggregation	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	IEA

MIM	HGNC	e!Ensembl
609201	29884	ENSG00000154127

Q8TF42

Protein name

Ubiquitin-associated and SH3 domain-containing protein B (EC 3.1.3.48) (Cbl-interacting protein p70) (Suppressor of T-cell receptor signaling 1) (STS-1) (T-cell ubiquitin ligand 2) (TULA-2) (Tyrosine-protein phosphatase STS1/TULA2)

Protein function

Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity t

PDB

2CPW , 2E5K , 5VR6 , 5W5G , 8U5M , 8U7E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00627	UBA	39 → 73	UBA/TS-N domain	Domain
PF14604	SH3_9	261 → 315	Variant SH3 domain	Domain
PF00300	His_Phos_1	426 → 610	Histidine phosphatase superfamily (branch 1)	Domain

Sequence

MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

Sequence length

649

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	30734961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9878560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17312329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22286903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17312329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28851315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19648476		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21861134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	19442274, 22455605, 30289285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	19442274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15083183, 24131622, 29492198, 30796030, 31173106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25193855, 27191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31063769, 31350168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17312329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	30849546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27840968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	9756640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15653324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29178617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36453946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	7718889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8656012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29274665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30234607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33556471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15388581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10525320, 12472178, 2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	2466842, 8464876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	12045200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11337356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15083183, 24131622, 29492198, 30796030, 31173106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24089522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25193855, 27191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28465372, 28714416		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26449661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12045200, 28782555, 29263213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	25485873, 31836699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29492198		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25193855, 27191261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	40486509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24739041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37678858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27840968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27896842, 9756640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28902714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29526493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	9856816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22286903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	23938603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	22805177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	25214013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	26209830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23784775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15653324		★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	12045200		★★★★★ ★☆☆☆☆ Found in Text Mining only

UBASH3B (ubiquitin associated and SH3 domain containing B)