Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84955
Gene name	NudC domain containing 1
Gene symbol	NUDCD1
Synonyms (NCBI Gene)	CML66OVA66
Chromosome	8
Chromosome location	8q23.1

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT447940	hsa-miR-4453	PAR-CLIP	22100165
MIRT447939	hsa-miR-4538	PAR-CLIP	22100165
MIRT447938	hsa-miR-205-3p	PAR-CLIP	22100165
MIRT447937	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT447936	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT447940	hsa-miR-4453	PAR-CLIP	22100165
MIRT447939	hsa-miR-4538	PAR-CLIP	22100165
MIRT447938	hsa-miR-205-3p	PAR-CLIP	22100165
MIRT447937	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT447936	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT447940	hsa-miR-4453	PAR-CLIP	22100165
MIRT447939	hsa-miR-4538	PAR-CLIP	22100165
MIRT447938	hsa-miR-205-3p	PAR-CLIP	22100165
MIRT447937	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT447936	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT447940	hsa-miR-4453	PAR-CLIP	22100165
MIRT447939	hsa-miR-4538	PAR-CLIP	22100165
MIRT447938	hsa-miR-205-3p	PAR-CLIP	22100165
MIRT447937	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT447936	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT1197268	hsa-miR-1298	CLIP-seq
MIRT1197269	hsa-miR-141	CLIP-seq
MIRT1197270	hsa-miR-1910	CLIP-seq
MIRT1197271	hsa-miR-200a	CLIP-seq
MIRT1197272	hsa-miR-216b	CLIP-seq
MIRT1197273	hsa-miR-219-2-3p	CLIP-seq
MIRT1197274	hsa-miR-2355-3p	CLIP-seq
MIRT1197275	hsa-miR-2964a-3p	CLIP-seq
MIRT1197276	hsa-miR-3117-3p	CLIP-seq
MIRT1197277	hsa-miR-3120-3p	CLIP-seq
MIRT1197278	hsa-miR-3129-3p	CLIP-seq
MIRT1197279	hsa-miR-3137	CLIP-seq
MIRT1197280	hsa-miR-3145-5p	CLIP-seq
MIRT1197281	hsa-miR-3169	CLIP-seq
MIRT1197282	hsa-miR-3183	CLIP-seq
MIRT1197283	hsa-miR-3664-3p	CLIP-seq
MIRT1197284	hsa-miR-3671	CLIP-seq
MIRT1197285	hsa-miR-3675-3p	CLIP-seq
MIRT1197286	hsa-miR-3688-5p	CLIP-seq
MIRT1197287	hsa-miR-4282	CLIP-seq
MIRT1197288	hsa-miR-4436a	CLIP-seq
MIRT1197289	hsa-miR-4477a	CLIP-seq
MIRT1197290	hsa-miR-4635	CLIP-seq
MIRT1197291	hsa-miR-4646-3p	CLIP-seq
MIRT1197292	hsa-miR-4680-3p	CLIP-seq
MIRT1197293	hsa-miR-4723-3p	CLIP-seq
MIRT1197294	hsa-miR-4731-3p	CLIP-seq
MIRT1197295	hsa-miR-4753-3p	CLIP-seq
MIRT1197296	hsa-miR-4759	CLIP-seq
MIRT1197297	hsa-miR-4796-5p	CLIP-seq
MIRT1197298	hsa-miR-4797-5p	CLIP-seq
MIRT1197299	hsa-miR-4801	CLIP-seq
MIRT1197300	hsa-miR-486-5p	CLIP-seq
MIRT1197301	hsa-miR-487a	CLIP-seq
MIRT1197302	hsa-miR-556-3p	CLIP-seq
MIRT1197303	hsa-miR-616	CLIP-seq
MIRT1197304	hsa-miR-627	CLIP-seq
MIRT1197305	hsa-miR-654-3p	CLIP-seq
MIRT1197306	hsa-miR-664	CLIP-seq
MIRT1197307	hsa-miR-922	CLIP-seq
MIRT1197308	hsa-miR-1284	CLIP-seq
MIRT1197309	hsa-miR-1303	CLIP-seq
MIRT1197274	hsa-miR-2355-3p	CLIP-seq
MIRT1197310	hsa-miR-29a	CLIP-seq
MIRT1197311	hsa-miR-29b	CLIP-seq
MIRT1197312	hsa-miR-29c	CLIP-seq
MIRT1197276	hsa-miR-3117-3p	CLIP-seq
MIRT1197313	hsa-miR-3123	CLIP-seq
MIRT1197314	hsa-miR-3124-3p	CLIP-seq
MIRT1197280	hsa-miR-3145-5p	CLIP-seq
MIRT1197281	hsa-miR-3169	CLIP-seq
MIRT1197315	hsa-miR-340	CLIP-seq
MIRT1197316	hsa-miR-3647-3p	CLIP-seq
MIRT1197285	hsa-miR-3675-3p	CLIP-seq
MIRT1197317	hsa-miR-3685	CLIP-seq
MIRT1197318	hsa-miR-376c	CLIP-seq
MIRT1197319	hsa-miR-384	CLIP-seq
MIRT1197320	hsa-miR-3925-5p	CLIP-seq
MIRT1197321	hsa-miR-409-5p	CLIP-seq
MIRT1197287	hsa-miR-4282	CLIP-seq
MIRT1197322	hsa-miR-4293	CLIP-seq
MIRT1197323	hsa-miR-4328	CLIP-seq
MIRT1197324	hsa-miR-4474-5p	CLIP-seq
MIRT1197325	hsa-miR-4503	CLIP-seq
MIRT1197326	hsa-miR-4517	CLIP-seq
MIRT1197291	hsa-miR-4646-3p	CLIP-seq
MIRT1197327	hsa-miR-4700-3p	CLIP-seq
MIRT1197295	hsa-miR-4753-3p	CLIP-seq
MIRT1197296	hsa-miR-4759	CLIP-seq
MIRT1197328	hsa-miR-4760-5p	CLIP-seq
MIRT1197329	hsa-miR-4795-3p	CLIP-seq
MIRT1197301	hsa-miR-487a	CLIP-seq
MIRT1197330	hsa-miR-554	CLIP-seq
MIRT1197331	hsa-miR-576-3p	CLIP-seq
MIRT1197332	hsa-miR-582-5p	CLIP-seq
MIRT1197333	hsa-miR-587	CLIP-seq
MIRT1197334	hsa-miR-590-3p	CLIP-seq
MIRT1197335	hsa-miR-596	CLIP-seq
MIRT1197277	hsa-miR-3120-3p	CLIP-seq
MIRT1197289	hsa-miR-4477a	CLIP-seq
MIRT1197300	hsa-miR-486-5p	CLIP-seq
MIRT1197307	hsa-miR-922	CLIP-seq
MIRT1197332	hsa-miR-582-5p	CLIP-seq
MIRT1197277	hsa-miR-3120-3p	CLIP-seq
MIRT1197300	hsa-miR-486-5p	CLIP-seq
MIRT1197307	hsa-miR-922	CLIP-seq
MIRT1197308	hsa-miR-1284	CLIP-seq
MIRT1197321	hsa-miR-409-5p	CLIP-seq
MIRT1197323	hsa-miR-4328	CLIP-seq
MIRT2391800	hsa-miR-548n	CLIP-seq
MIRT2391801	hsa-miR-548t	CLIP-seq
MIRT1197332	hsa-miR-582-5p	CLIP-seq
MIRT1197333	hsa-miR-587	CLIP-seq
MIRT1197277	hsa-miR-3120-3p	CLIP-seq
MIRT1197300	hsa-miR-486-5p	CLIP-seq
MIRT1197307	hsa-miR-922	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	25036637, 29021621, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA

MIM	HGNC	e!Ensembl
606109	24306	ENSG00000120526

Q96RS6

Protein name

NudC domain-containing protein 1 (Chronic myelogenous leukemia tumor antigen 66) (Tumor antigen CML66)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04969	CS	276 → 350	CS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is specifically expressed in leukemias and a variety of solid tumor cell lines and is also detected in testis and heart. Isoform 2 is predominantly expressed in testis and weakly expressed in tumor cells. {ECO:0000269|PubMed:

Sequence

MEVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQYTLEHMHAFG
MYNYLHCDSWYQDSVYYIDTLGRIMNLTVMLDTALGKPREVFRLPTDLTACDNRLCASIH
FSSSTWVTLSDGTGRLYVIGTGERGNSASEKWEIMFNEELGDPFIIIHSISLLNAEEHSI
ATLLLRIEKEELDMKGSGFYVSLEWVTISKKNQDNKKYEIIKRDILRGKSVPHYAAIEPD
GNGLMIVSYKSLTFVQAGQDLEENMDEDISEKIKEPLYYWQQTEDDLTVTIRLPEDSTKE
DIQIQFLPDHINIVLKDHQFLEGKLYSSIDHESSTWIIKESNSLEISLIKKNEGLTWPEL
VIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSL
CRFDGNTLKTTHVVNLGSNQYLFSVIVDPKEMPCFCLRHDVDALLWQPHSSKQDDMWEHI
ATFNALGYVQASKRDKKFFACAPNYSYAALCECLRRVFIYRQPAPMSTVLYNRKEGRQVG
QVAKQQVASLETNDPILGFQATNERLFVLTTKNLFLIKVNTEN

Sequence length

583

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15958636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38553373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30138346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29461594	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24667688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29888104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36104662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29461594, 29511446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33336728	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11416219, 15958636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18422754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18422754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15958636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11416219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33336728	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36104662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24667688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11416219, 18534745, 24633332, 30833190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11416219, 15958636, 29021621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18534745, 24633332, 24667688, 30833190		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24667688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11416219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11416219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29461594, 29511446		★★★★★ ★☆☆☆☆ Found in Text Mining only

NUDCD1 (NudC domain containing 1)