Gene Gene information from NCBI Gene database.
Entrez ID 84947
Gene name Serine active site containing 1
Gene symbol SERAC1
Synonyms (NCBI Gene)
-
Chromosome 6
Chromosome location 6q25.3
Summary The protein encoded by this gene is a phosphatidylglycerol remodeling protein found at the interface of mitochondria and endoplasmic reticula, where it mediates phospholipid exchange. The encoded protein plays a major role in mitochondrial function and in
SNPs SNP information provided by dbSNP.
27
SNP ID Visualize variation Clinical significance Consequence
rs139301835 G>A,C,T Likely-pathogenic, uncertain-significance Non coding transcript variant, synonymous variant, 5 prime UTR variant, genic upstream transcript variant, stop gained, missense variant, coding sequence variant
rs199632531 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant
rs201941476 C>G Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs387907236 G>A Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs529232938 G>A Pathogenic Coding sequence variant, 5 prime UTR variant, non coding transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
297
miRTarBase ID miRNA Experiments Reference
MIRT019450 hsa-miR-148b-3p Microarray 17612493
MIRT021468 hsa-miR-9-5p Microarray 17612493
MIRT023363 hsa-miR-122-5p Microarray 17612493
MIRT024800 hsa-miR-215-5p Microarray 19074876
MIRT026696 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 22683713
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IEA
GO:0005783 Component Endoplasmic reticulum IDA 22683713
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614725 21061 ENSG00000122335
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96JX3
Protein name Protein SERAC1 (Serine active site-containing protein 1)
Protein function Facilitates the transport of serine from the cytosol to the mitochondria by interacting with and stabilizing Sideroflexin-1 (SFXN1), a mitochondrial serine transporter, playing a fundamental role in the one-carbon cycle responsible for the synth
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with predominant expression in skeletal muscle and brain (PubMed:22683713, PubMed:35235340). In the brain, highest levels are found in the frontal and occipital cortices, cerebellum and hippocampus (PubMed:22683713).
Sequence
MSLAAYCVICCRRIGTSTSPPKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVT
LDTQVVEREKMKSYIYVHTVSLDKGENHGIAWQARKELHKAVRKVLATSAKILRNPFADP
FSTVDIEDHECAVWLLLRKSKSDDKTTRLEAVREMSETHHWHDYQYRIIAQACDPKTLIG
LARSEESDLRFFLLPPPLPSLKEDSSTEEELRQLLASLPQTELDECIQYFTSLALSESSQ
SLAAQKGGLWCFGGNGLPYAESFGEVPSATVEMFCLEAIVKHSEISTHCDKIEANGGLQL
LQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAA
RILANLDRETVQEKYQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVI
EKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLR
KLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHGSRLA
EYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIK
LHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALAKDLEN
Sequence length 654
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
21
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome Pathogenic; Likely pathogenic rs2128409409, rs529232938, rs759351997, rs2128410576, rs1131690799, rs1383515185, rs756065709, rs1785136884, rs978448154, rs927446955, rs797045105, rs767780913, rs780275814, rs199632531, rs886041750
View all (23 more)
RCV001542661
RCV000106307
RCV001799538
RCV002032263
RCV001946827
View all (34 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial oxidative phosphorylation disorder Likely pathogenic rs139301835 RCV000616269
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ovarian serous cystadenocarcinoma Likely pathogenic rs1274076957 RCV005934695
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SERAC1-related disorder Likely pathogenic; Pathogenic rs1245168537, rs1554260851, rs201941476 RCV004729146
RCV003889905
RCV003336206
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEAFNESS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria BEFREE 23296368
★☆☆☆☆
Found in Text Mining only
3-methylglutaconic aciduria type IV with sensorineural deafness, encephalopathy and Leigh-like syndrome 3-Methylglutaconic Aciduria With Sensorineural Deafness, Encephalopathy And Leigh-Like Syndrome GENOMICS_ENGLAND_DG 16527507, 27186703, 27604308
★☆☆☆☆
Found in Text Mining only
3-methylglutaconic aciduria type IV with sensorineural deafness, encephalopathy and Leigh-like syndrome 3-Methylglutaconic Aciduria With Sensorineural Deafness, Encephalopathy And Leigh-Like Syndrome BEFREE 22683713, 23707711, 23918762, 25051967, 25595726, 28778788
★☆☆☆☆
Found in Text Mining only
Anodontia Anodontia Pubtator 39592976 Associate
★☆☆☆☆
Found in Text Mining only
Blood Coagulation Disorders Blood Coagulation Disorders HPO_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 29205472, 34751152 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 18460216, 35589867 Associate
★☆☆☆☆
Found in Text Mining only
Cerebellar atrophy Cerebellar atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only