RNFT2 (ring finger protein, transmembrane 2)

Gene

• Entrez ID: 84900
• Gene name: Ring finger protein, transmembrane 2
• Gene symbol: RNFT2
• Synonyms (NCBI Gene): TMEM118
• Chromosome: 12
• Chromosome location: 12q24.22

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048111	hsa-miR-197-3p	CLASH	23622248
MIRT1313912	hsa-miR-1256	CLIP-seq
MIRT1313913	hsa-miR-1303	CLIP-seq
MIRT1313914	hsa-miR-2116	CLIP-seq
MIRT1313915	hsa-miR-3064-5p	CLIP-seq
MIRT1313916	hsa-miR-3123	CLIP-seq
MIRT1313917	hsa-miR-3152-3p	CLIP-seq
MIRT1313918	hsa-miR-3160-5p	CLIP-seq
MIRT1313919	hsa-miR-3925-5p	CLIP-seq
MIRT1313920	hsa-miR-4273	CLIP-seq
MIRT1313921	hsa-miR-4311	CLIP-seq
MIRT1313922	hsa-miR-4677-5p	CLIP-seq
MIRT1313923	hsa-miR-4693-3p	CLIP-seq
MIRT1313924	hsa-miR-4774-5p	CLIP-seq
MIRT1313925	hsa-miR-604	CLIP-seq
MIRT1313926	hsa-miR-647	CLIP-seq
MIRT2093393	hsa-miR-1208	CLIP-seq
MIRT2093394	hsa-miR-4446-5p	CLIP-seq
MIRT2093395	hsa-miR-452	CLIP-seq
MIRT2093396	hsa-miR-4676-3p	CLIP-seq
MIRT2093397	hsa-miR-4755-5p	CLIP-seq
MIRT2317943	hsa-miR-1205	CLIP-seq
MIRT2317944	hsa-miR-1225-5p	CLIP-seq
MIRT2317945	hsa-miR-3622b-5p	CLIP-seq
MIRT2317946	hsa-miR-4514	CLIP-seq
MIRT2317947	hsa-miR-4692	CLIP-seq
MIRT2317948	hsa-miR-4731-5p	CLIP-seq
MIRT2317949	hsa-miR-4768-3p	CLIP-seq
MIRT2317950	hsa-miR-665	CLIP-seq
MIRT2317951	hsa-miR-940	CLIP-seq
MIRT2393851	hsa-miR-1913	CLIP-seq
MIRT2393852	hsa-miR-324-3p	CLIP-seq
MIRT2613624	hsa-miR-1236	CLIP-seq
MIRT2613625	hsa-miR-141	CLIP-seq
MIRT2613626	hsa-miR-200a	CLIP-seq
MIRT2613627	hsa-miR-23a	CLIP-seq
MIRT2613628	hsa-miR-23b	CLIP-seq
MIRT2613629	hsa-miR-23c	CLIP-seq
MIRT2613630	hsa-miR-3130-3p	CLIP-seq
MIRT2613631	hsa-miR-3145-3p	CLIP-seq
MIRT2613632	hsa-miR-3657	CLIP-seq
MIRT2613633	hsa-miR-3938	CLIP-seq
MIRT2613634	hsa-miR-4659a-3p	CLIP-seq
MIRT2613635	hsa-miR-4659b-3p	CLIP-seq
MIRT2613636	hsa-miR-4669	CLIP-seq
MIRT2613637	hsa-miR-4671-5p	CLIP-seq
MIRT2613638	hsa-miR-4729	CLIP-seq
MIRT2613639	hsa-miR-4753-3p	CLIP-seq
MIRT2613640	hsa-miR-4793-3p	CLIP-seq
MIRT2613641	hsa-miR-4795-3p	CLIP-seq
MIRT2613642	hsa-miR-487a	CLIP-seq
MIRT2613643	hsa-miR-501-3p	CLIP-seq
MIRT2613644	hsa-miR-502-3p	CLIP-seq
MIRT2613645	hsa-miR-513c	CLIP-seq
MIRT2613646	hsa-miR-514b-5p	CLIP-seq
MIRT2613647	hsa-miR-642a	CLIP-seq
MIRT2613648	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:1904294	Process	Positive regulation of ERAD pathway	IEA

Other IDs

• MIM: 620254
• HGNC: 25905
• e!Ensembl: ENSG00000135119

Protein

• UniProt ID: Q96EX2
• Protein name: E3 ubiquitin-protein ligase RNFT2 (RING finger and transmembrane domain-containing protein 2) (Transmembrane protein 118)
• Protein function: E3 ubiquitin-protein ligase that negatively regulates IL3-dependent cellular responses through IL3RA ubiquitination and degradation by the proteasome, having an anti-inflammatory effect.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13923	zf-C3HC4_2	383 → 421		Domain

• Sequence:

  MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF
  SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG
  HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ
  HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL
  YNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV
  IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK
  LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL
  CRSVAVDTLRCWKDGATSAHFQVY

• Sequence length: 444

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	34762840	Associate	★☆☆☆☆ Found in Text Mining only