Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8490
Gene name	Regulator of G protein signaling 5
Gene symbol	RGS5
Synonyms (NCBI Gene)	MST092MST106MST129MSTP032MSTP092MSTP106MSTP129
Chromosome	1
Chromosome location	1q23.3
Summary	This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-i

190

Show/Hide all (190)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021577	hsa-miR-142-3p	Microarray	17612493
MIRT437944	hsa-miR-20a-5p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT437943	hsa-miR-92a-3p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT437942	hsa-miR-181a-5p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT437944	hsa-miR-20a-5p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT437943	hsa-miR-92a-3p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT437942	hsa-miR-181a-5p	ChIP-seqqRT-PCRLuciferase reporter assay	23308108
MIRT647924	hsa-miR-1243	HITS-CLIP	23824327
MIRT647923	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647922	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647921	hsa-miR-378j	HITS-CLIP	23824327
MIRT647920	hsa-miR-6839-5p	HITS-CLIP	23824327
MIRT647919	hsa-miR-3167	HITS-CLIP	23824327
MIRT647918	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT647917	hsa-miR-1290	HITS-CLIP	23824327
MIRT647916	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647915	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT639591	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT639590	hsa-miR-1248	HITS-CLIP	23824327
MIRT639589	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639588	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT639587	hsa-miR-6083	HITS-CLIP	23824327
MIRT639586	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT569856	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT569855	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT569854	hsa-miR-595	PAR-CLIP	20371350
MIRT569853	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT569852	hsa-miR-4706	PAR-CLIP	20371350
MIRT569851	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT569850	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT569849	hsa-miR-663a	PAR-CLIP	20371350
MIRT569848	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT569847	hsa-miR-567	PAR-CLIP	20371350
MIRT569846	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT569845	hsa-miR-3911	PAR-CLIP	20371350
MIRT569843	hsa-miR-644a	PAR-CLIP	20371350
MIRT569844	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT569842	hsa-miR-297	PAR-CLIP	20371350
MIRT569841	hsa-miR-147a	PAR-CLIP	20371350
MIRT569840	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT446907	hsa-miR-4255	PAR-CLIP	22100165
MIRT446905	hsa-miR-4635	PAR-CLIP	22100165
MIRT446906	hsa-miR-124-5p	PAR-CLIP	22100165
MIRT446904	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446903	hsa-miR-578	PAR-CLIP	22100165
MIRT647924	hsa-miR-1243	HITS-CLIP	23824327
MIRT647923	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647922	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647921	hsa-miR-378j	HITS-CLIP	23824327
MIRT647920	hsa-miR-6839-5p	HITS-CLIP	23824327
MIRT647919	hsa-miR-3167	HITS-CLIP	23824327
MIRT647918	hsa-miR-876-5p	HITS-CLIP	23824327
MIRT647917	hsa-miR-1290	HITS-CLIP	23824327
MIRT647916	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647915	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT639591	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT639590	hsa-miR-1248	HITS-CLIP	23824327
MIRT639589	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639588	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT639587	hsa-miR-6083	HITS-CLIP	23824327
MIRT639586	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT569856	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT569855	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT569854	hsa-miR-595	PAR-CLIP	20371350
MIRT569853	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT569852	hsa-miR-4706	PAR-CLIP	20371350
MIRT569851	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT569850	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT569849	hsa-miR-663a	PAR-CLIP	20371350
MIRT569848	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT569847	hsa-miR-567	PAR-CLIP	20371350
MIRT569846	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT569845	hsa-miR-3911	PAR-CLIP	20371350
MIRT569843	hsa-miR-644a	PAR-CLIP	20371350
MIRT569844	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT569842	hsa-miR-297	PAR-CLIP	20371350
MIRT569841	hsa-miR-147a	PAR-CLIP	20371350
MIRT569840	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT446907	hsa-miR-4255	PAR-CLIP	22100165
MIRT446905	hsa-miR-4635	PAR-CLIP	22100165
MIRT446906	hsa-miR-124-5p	PAR-CLIP	22100165
MIRT446904	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446903	hsa-miR-578	PAR-CLIP	22100165
MIRT1304441	hsa-miR-129-5p	CLIP-seq
MIRT1304442	hsa-miR-450b-5p	CLIP-seq
MIRT1304443	hsa-miR-4652-3p	CLIP-seq
MIRT1304444	hsa-miR-4698	CLIP-seq
MIRT1304445	hsa-miR-4778-5p	CLIP-seq
MIRT1304446	hsa-miR-507	CLIP-seq
MIRT1304447	hsa-miR-518a-5p	CLIP-seq
MIRT1304448	hsa-miR-527	CLIP-seq
MIRT1304449	hsa-miR-557	CLIP-seq
MIRT1304450	hsa-miR-1228	CLIP-seq
MIRT1304451	hsa-miR-1289	CLIP-seq
MIRT1304452	hsa-miR-129-3p	CLIP-seq
MIRT1304453	hsa-miR-219-2-3p	CLIP-seq
MIRT1304454	hsa-miR-2964a-3p	CLIP-seq
MIRT1304455	hsa-miR-3198	CLIP-seq
MIRT1304456	hsa-miR-323-3p	CLIP-seq
MIRT1304457	hsa-miR-3616-5p	CLIP-seq
MIRT1304458	hsa-miR-3647-5p	CLIP-seq
MIRT1304459	hsa-miR-3682-5p	CLIP-seq
MIRT1304460	hsa-miR-3688-3p	CLIP-seq
MIRT1304461	hsa-miR-377	CLIP-seq
MIRT1304462	hsa-miR-3908	CLIP-seq
MIRT1304463	hsa-miR-3942-3p	CLIP-seq
MIRT1304464	hsa-miR-3942-5p	CLIP-seq
MIRT1304465	hsa-miR-4279	CLIP-seq
MIRT1304466	hsa-miR-4294	CLIP-seq
MIRT1304467	hsa-miR-4309	CLIP-seq
MIRT1304468	hsa-miR-455-3p	CLIP-seq
MIRT1304469	hsa-miR-4670-3p	CLIP-seq
MIRT1304470	hsa-miR-4703-5p	CLIP-seq
MIRT1304471	hsa-miR-4729	CLIP-seq
MIRT1304472	hsa-miR-4742-3p	CLIP-seq
MIRT1304473	hsa-miR-4766-3p	CLIP-seq
MIRT1304474	hsa-miR-4775	CLIP-seq
MIRT1304475	hsa-miR-513a-5p	CLIP-seq
MIRT1304476	hsa-miR-556-3p	CLIP-seq
MIRT1304477	hsa-miR-572	CLIP-seq
MIRT1304478	hsa-miR-573	CLIP-seq
MIRT1304479	hsa-miR-579	CLIP-seq
MIRT1304480	hsa-miR-587	CLIP-seq
MIRT1304481	hsa-miR-590-3p	CLIP-seq
MIRT1304482	hsa-miR-718	CLIP-seq
MIRT1304483	hsa-miR-924	CLIP-seq
MIRT1304484	hsa-miR-944	CLIP-seq
MIRT1553090	hsa-miR-501-3p	CLIP-seq
MIRT1553091	hsa-miR-502-3p	CLIP-seq
MIRT1553092	hsa-miR-767-5p	CLIP-seq
MIRT2090207	hsa-miR-135a	CLIP-seq
MIRT2090208	hsa-miR-135b	CLIP-seq
MIRT1304453	hsa-miR-219-2-3p	CLIP-seq
MIRT1304454	hsa-miR-2964a-3p	CLIP-seq
MIRT1304461	hsa-miR-377	CLIP-seq
MIRT1304463	hsa-miR-3942-3p	CLIP-seq
MIRT2314937	hsa-miR-103a	CLIP-seq
MIRT2314938	hsa-miR-107	CLIP-seq
MIRT2314939	hsa-miR-15a	CLIP-seq
MIRT2314940	hsa-miR-15b	CLIP-seq
MIRT2314941	hsa-miR-16	CLIP-seq
MIRT2314942	hsa-miR-195	CLIP-seq
MIRT2314943	hsa-miR-214	CLIP-seq
MIRT1304453	hsa-miR-219-2-3p	CLIP-seq
MIRT2314944	hsa-miR-224	CLIP-seq
MIRT1304454	hsa-miR-2964a-3p	CLIP-seq
MIRT2314945	hsa-miR-3153	CLIP-seq
MIRT2314946	hsa-miR-3160-5p	CLIP-seq
MIRT1304457	hsa-miR-3616-5p	CLIP-seq
MIRT2314947	hsa-miR-3619-5p	CLIP-seq
MIRT2314948	hsa-miR-3622b-5p	CLIP-seq
MIRT1304458	hsa-miR-3647-5p	CLIP-seq
MIRT1304461	hsa-miR-377	CLIP-seq
MIRT1304463	hsa-miR-3942-3p	CLIP-seq
MIRT2314949	hsa-miR-3945	CLIP-seq
MIRT2314950	hsa-miR-424	CLIP-seq
MIRT2314951	hsa-miR-4291	CLIP-seq
MIRT2314952	hsa-miR-4493	CLIP-seq
MIRT2314953	hsa-miR-4524	CLIP-seq
MIRT2314954	hsa-miR-4719	CLIP-seq
MIRT2314955	hsa-miR-4761-3p	CLIP-seq
MIRT2314956	hsa-miR-4768-5p	CLIP-seq
MIRT2314957	hsa-miR-4795-3p	CLIP-seq
MIRT2314958	hsa-miR-485-3p	CLIP-seq
MIRT2314959	hsa-miR-495	CLIP-seq
MIRT2314960	hsa-miR-497	CLIP-seq
MIRT2314961	hsa-miR-503	CLIP-seq
MIRT2314962	hsa-miR-526b	CLIP-seq
MIRT1304478	hsa-miR-573	CLIP-seq
MIRT2314963	hsa-miR-630	CLIP-seq
MIRT2314964	hsa-miR-646	CLIP-seq
MIRT2314965	hsa-miR-656	CLIP-seq
MIRT2314966	hsa-miR-761	CLIP-seq
MIRT2314967	hsa-miR-922	CLIP-seq
MIRT2314968	hsa-miR-936	CLIP-seq
MIRT2458149	hsa-miR-299-3p	CLIP-seq
MIRT2458150	hsa-miR-34c-3p	CLIP-seq
MIRT2458151	hsa-miR-4420	CLIP-seq
MIRT1304450	hsa-miR-1228	CLIP-seq
MIRT1304461	hsa-miR-377	CLIP-seq
MIRT1304462	hsa-miR-3908	CLIP-seq
MIRT1304464	hsa-miR-3942-5p	CLIP-seq
MIRT1304470	hsa-miR-4703-5p	CLIP-seq
MIRT1304473	hsa-miR-4766-3p	CLIP-seq
MIRT1304450	hsa-miR-1228	CLIP-seq
MIRT1304461	hsa-miR-377	CLIP-seq
MIRT1304462	hsa-miR-3908	CLIP-seq
MIRT1304464	hsa-miR-3942-5p	CLIP-seq
MIRT1304470	hsa-miR-4703-5p	CLIP-seq
MIRT1304473	hsa-miR-4766-3p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	TAS	10471929
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10471929
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA

MIM	HGNC	e!Ensembl
603276	10001	ENSG00000143248

O15539

Protein name

Regulator of G-protein signaling 5 (RGS5)

Protein function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha (By similarity).

PDB

2CRP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	64 → 179	Regulator of G protein signaling domain	Domain

Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQ
WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI
K

Sequence length

181

Interactions

View interactions

	Reactome
			G alpha (q) signalling events G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIAC EMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, ESSENTIAL	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPROSTHETIC OSTEOLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	31605122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22281988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15459006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16293795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31605122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	31147874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19488044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37594134, 38012271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15154008, 31049219, 37960718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25891540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30365142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34212534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22130514, 30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26782409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	36111549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30354999, 31039042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11072240, 15095478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31605122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31625976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	17236131	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	19863299, 26782409		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	22312193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	35529258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	30690792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	35681135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	35681135	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Secondary	Hyperparathyroidism	Pubtator	35681135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	30690792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17236131, 21881522, 32041970	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	1798635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	19863299, 21881522, 26782409, 29061726, 29208700		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	30365142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36111549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15154008, 23868206, 28330473, 29434872, 31423211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31049219	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23868206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25891540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22130514, 30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22130514, 23868206, 25891540, 29434872, 30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22130514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31625976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29534968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15095478, 15459006, 19467451, 22130514, 24777966, 26585578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14504426, 22788371		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22130514, 30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30365142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30365142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	21393447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	21393447, 30690792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	30365142	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11072240, 15095478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30650360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18262772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18262772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18262772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	18197262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31049219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21105200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	33445220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37963845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS5 (regulator of G protein signaling 5)