Gene Gene information from NCBI Gene database.
Entrez ID 84896
Gene name ATPase family AAA domain containing 1
Gene symbol ATAD1
Synonyms (NCBI Gene)
AFDC1FNP001HKPX4Msp1THORASEhATAD1
Chromosome 10
Chromosome location 10q23.31
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs751499706 AT>- Pathogenic Coding sequence variant, frameshift variant, non coding transcript variant, genic downstream transcript variant
rs1554874859 C>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
366
miRTarBase ID miRNA Experiments Reference
MIRT024433 hsa-miR-215-5p Microarray 19074876
MIRT026753 hsa-miR-192-5p Microarray 19074876
MIRT041617 hsa-miR-146b-5p CLASH 23622248
MIRT052731 hsa-miR-1260b CLASH 23622248
MIRT441169 hsa-miR-218-5p HITS-CLIP 23212916
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0002092 Process Positive regulation of receptor internalization IEA
GO:0002092 Process Positive regulation of receptor internalization ISS
GO:0005524 Function ATP binding IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614452 25903 ENSG00000138138
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NBU5
Protein name Outer mitochondrial transmembrane helix translocase (EC 7.4.2.-) (ATPase family AAA domain-containing protein 1) (hATAD1) (Thorase)
Protein function Outer mitochondrial translocase required to remove mislocalized tail-anchored transmembrane proteins on mitochondria (PubMed:24843043). Specifically recognizes and binds tail-anchored transmembrane proteins: acts as a dislocase that mediates the
PDB 7UPR , 7UPT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00004 AAA 129 259 ATPase family associated with various cellular activities (AAA) Domain
PF17862 AAA_lid_3 281 336 AAA+ lid domain Domain
Sequence
MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMK
QIGVKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENS
RLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSL
AIKLQPSIIFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRP
QDLDSAIMRRMPTRFHINQ
PALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLK
EMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDL
HRAIEKMKKSKDAAFQNVLTHVCL
D
Sequence length 361
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Class I peroxisomal membrane protein import
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Hyperekplexia 4 Likely pathogenic; Pathogenic rs1554874859, rs751499706 RCV000656481
RCV000656482
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATAD1-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEREDITARY HYPEREKPLEXIA CTD, Orphanet
CTD, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEREDITARY HYPEREXPLEXIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired Kyphoscoliosis Acquired Kyphoscoliosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Acute Cerebrovascular Accidents Stroke BEFREE 9099202
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 22365406
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 1382719
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 18066497
★☆☆☆☆
Found in Text Mining only
Alpha trait thalassemia alpha Thalassemia BEFREE 25604491
★☆☆☆☆
Found in Text Mining only
alpha-Thalassemia alpha Thalassemia BEFREE 19460160
★☆☆☆☆
Found in Text Mining only
alpha^+^ Thalassemia alpha Thalassemia BEFREE 19460160
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 12896855
★☆☆☆☆
Found in Text Mining only
Anemia Anemia BEFREE 20097151
★☆☆☆☆
Found in Text Mining only