LINGO1 (leucine rich repeat and Ig domain containing 1)

Gene

• Entrez ID: 84894
• Gene name: Leucine rich repeat and Ig domain containing 1
• Gene symbol: LINGO1
• Synonyms (NCBI Gene): LERN1, LRRN6A, MRT64, UNQ201
• Chromosome: 15
• Chromosome location: 15q24.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT573965	hsa-miR-6077	PAR-CLIP	20371350
MIRT573964	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT573963	hsa-miR-765	PAR-CLIP	20371350
MIRT573962	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT736920	hsa-miR-15b-3p	Luciferase reporter assay, Western blotting, RNA-seq, Immunofluorescence, qRT-PCR	34187584
MIRT573965	hsa-miR-6077	PAR-CLIP	20371350
MIRT573964	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT573963	hsa-miR-765	PAR-CLIP	20371350
MIRT573962	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT1110512	hsa-miR-15a	CLIP-seq
MIRT1110513	hsa-miR-15b	CLIP-seq
MIRT1110514	hsa-miR-16	CLIP-seq
MIRT1110515	hsa-miR-185	CLIP-seq
MIRT1110516	hsa-miR-195	CLIP-seq
MIRT1110517	hsa-miR-198	CLIP-seq
MIRT1110518	hsa-miR-3120-3p	CLIP-seq
MIRT1110519	hsa-miR-3157-5p	CLIP-seq
MIRT1110520	hsa-miR-3649	CLIP-seq
MIRT1110521	hsa-miR-3665	CLIP-seq
MIRT1110522	hsa-miR-424	CLIP-seq
MIRT1110523	hsa-miR-4306	CLIP-seq
MIRT1110524	hsa-miR-4467	CLIP-seq
MIRT1110525	hsa-miR-4468	CLIP-seq
MIRT1110526	hsa-miR-4487	CLIP-seq
MIRT1110527	hsa-miR-4644	CLIP-seq
MIRT1110528	hsa-miR-4691-3p	CLIP-seq
MIRT1110529	hsa-miR-4693-3p	CLIP-seq
MIRT1110530	hsa-miR-4755-3p	CLIP-seq
MIRT1110531	hsa-miR-497	CLIP-seq
MIRT1110532	hsa-miR-520a-5p	CLIP-seq
MIRT1110533	hsa-miR-525-5p	CLIP-seq
MIRT1110534	hsa-miR-922	CLIP-seq
MIRT2030888	hsa-miR-1909	CLIP-seq
MIRT2030889	hsa-miR-4532	CLIP-seq
MIRT2030890	hsa-miR-4632	CLIP-seq
MIRT2030891	hsa-miR-4787-5p	CLIP-seq
MIRT2030892	hsa-miR-615-5p	CLIP-seq
MIRT2261538	hsa-miR-1253	CLIP-seq
MIRT2261539	hsa-miR-3173-3p	CLIP-seq
MIRT2261540	hsa-miR-3661	CLIP-seq
MIRT2030891	hsa-miR-4787-5p	CLIP-seq
MIRT2261541	hsa-miR-631	CLIP-seq
MIRT2390165	hsa-miR-1285	CLIP-seq
MIRT2390166	hsa-miR-3187-5p	CLIP-seq
MIRT2390167	hsa-miR-3529	CLIP-seq
MIRT2390168	hsa-miR-378g	CLIP-seq
MIRT2390169	hsa-miR-379	CLIP-seq
MIRT2390170	hsa-miR-4303	CLIP-seq
MIRT2390171	hsa-miR-4451	CLIP-seq
MIRT2390172	hsa-miR-4486	CLIP-seq
MIRT2390173	hsa-miR-4649-3p	CLIP-seq
MIRT2390174	hsa-miR-4650-3p	CLIP-seq
MIRT2390175	hsa-miR-612	CLIP-seq
MIRT2561559	hsa-miR-1224-3p	CLIP-seq
MIRT2561560	hsa-miR-296-5p	CLIP-seq
MIRT2561561	hsa-miR-342-5p	CLIP-seq
MIRT2561562	hsa-miR-4651	CLIP-seq
MIRT2561563	hsa-miR-4664-5p	CLIP-seq
MIRT2561564	hsa-miR-4758-3p	CLIP-seq
MIRT2561565	hsa-miR-541	CLIP-seq
MIRT2561566	hsa-miR-608	CLIP-seq
MIRT2561567	hsa-miR-654-5p	CLIP-seq
MIRT2561568	hsa-miR-766	CLIP-seq
MIRT2561559	hsa-miR-1224-3p	CLIP-seq
MIRT2561560	hsa-miR-296-5p	CLIP-seq
MIRT2561561	hsa-miR-342-5p	CLIP-seq
MIRT2561562	hsa-miR-4651	CLIP-seq
MIRT2561563	hsa-miR-4664-5p	CLIP-seq
MIRT2561564	hsa-miR-4758-3p	CLIP-seq
MIRT2561565	hsa-miR-541	CLIP-seq
MIRT2561566	hsa-miR-608	CLIP-seq
MIRT2561567	hsa-miR-654-5p	CLIP-seq
MIRT2561568	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	14966521, 17726113, 20659559, 22133804, 25416956, 32296183, 32814053, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0048666	Process	Neuron development	IBA

Other IDs

• MIM: 609791
• HGNC: 21205
• e!Ensembl: ENSG00000169783

Protein

• UniProt ID: Q96FE5
• Protein name: Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (Leucine-rich repeat and immunoglobulin domain-containing protein 1) (Leucine-rich repeat neuronal protein 1) (Leucine-rich repeat neuronal protein 6A)
• Protein function: Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors (PubMed:14966521, PubMed:15694321). Is also an important negative reg
• PDB: 2ID5, 4OQT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	71 → 131	Leucine rich repeat	Repeat
  PF13855	LRR_8	95 → 155	Leucine rich repeat	Repeat
  PF13855	LRR_8	119 → 179	Leucine rich repeat	Repeat
  PF13855	LRR_8	143 → 203	Leucine rich repeat	Repeat
  PF13855	LRR_8	311 → 371	Leucine rich repeat	Repeat
  PF07679	I-set	426 → 514	Immunoglobulin I-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed exclusively in the central nervous system. Highest level in the in amygdala, hippocampus, thalamus and cerebral cortex. In the rest of the brain a basal expression seems to be always present. Up-regulated in substantia nigra
• Sequence:

  MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRK
  RFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFN
  LRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLV
  YISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
  LKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIS
  TIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGN
  LETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT
  CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDG
  TLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGE
  ANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPR
  KSDAGISSADAPRKFNMKMI

• Sequence length: 620

Pathways

Reactome:

Axonal growth inhibition (RHOA activation)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual disability, autosomal recessive 64	Pathogenic	rs757077698, rs750612085	RCV000678221 RCV000678222	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, AUTOSOMAL RECESSIVE 64	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LINGO1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 64	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	34600516	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22503546	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	23543187	Associate	★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	28837161		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28966634		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28966634		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	31928294	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	19182806, 19553813, 19720553, 19908305, 20117178, 20310002, 20369371, 20372186, 20468067, 20489616, 20600614, 20951767, 20957646, 21158743, 21219542, 21470193, 21506150, 21734494, 21752692, 22104011, 22166413, 22425540, 23596072, 23682623, 23754655, 23951268, 24531928, 24532269, 25862159, 26411503, 27797806, 28382111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	GWASCAT_DG	19182806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	GWASDB_DG	19182806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	CTD_human_DG	19182806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	19720553, 19908305, 20369371, 20372186, 23543187, 23574883, 23951268	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	31932443	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	26979953		★☆☆☆☆ Found in Text Mining only
Familial Tremor	Tremor	CTD_human_DG	19182806		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	19422885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	24158112	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28837161		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28837161	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	28837161	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 64	Mental retardation	GENOMICS_ENGLAND_DG	28837161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 64	Mental retardation	UNIPROT_DG	28837161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 64	Mental retardation	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	BEFREE	28837161		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	28837161	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	21470193		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	23574883	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17239012, 23574883, 25862159, 27344330, 28885860		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17239012		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23574883	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26979953		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23574883	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25862159, 28382111		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Hereditary essential tremor	Hereditary Essential Tremor	Orphanet			★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	19422885		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	28105588		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17726113, 19720553, 19908305, 20117178, 20369371, 20468067, 20489616, 20951767, 21470193, 21506150, 21752692, 22123311, 22710005, 23596072, 24531928, 25862159, 26254004		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19720553, 19908305, 20369371	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31932443	Stimulate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	17726113		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tremor	Tremor	Pubtator	31932443	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	22710967		★☆☆☆☆ Found in Text Mining only