ADO (2-aminoethanethiol dioxygenase)

Gene

• Entrez ID: 84890
• Gene name: 2-aminoethanethiol dioxygenase
• Gene symbol: ADO
• Synonyms (NCBI Gene): C10orf22
• Chromosome: 10
• Chromosome location: 10q21.3
• Summary: Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020373	hsa-miR-29c-3p	Sequencing	20371350
MIRT022087	hsa-miR-128-3p	Sequencing	20371350
MIRT023381	hsa-miR-122-5p	Microarray	17612493
MIRT025531	hsa-miR-34a-5p	Sequencing	20371350
MIRT025852	hsa-miR-7-5p	Microarray	19073608
MIRT027340	hsa-miR-101-3p	Sequencing	20371350
MIRT048683	hsa-miR-99a-5p	CLASH	23622248
MIRT689081	hsa-miR-552-3p	HITS-CLIP	23313552
MIRT689080	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT689079	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT689078	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT689077	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT689075	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT689076	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT689074	hsa-miR-5095	HITS-CLIP	23313552
MIRT689073	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT689072	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT639004	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT639003	hsa-miR-764	HITS-CLIP	23824327
MIRT639002	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT639001	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT639000	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT638999	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT638998	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT638997	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT638996	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT638995	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT638994	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT367537	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT615553	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT615553	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT177711	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT177712	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT177710	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT177713	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT177709	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT568590	hsa-miR-4432	PAR-CLIP	20371350
MIRT568591	hsa-miR-8087	PAR-CLIP	20371350
MIRT177718	hsa-miR-548ag	PAR-CLIP	20371350
MIRT177719	hsa-miR-548ai	PAR-CLIP	20371350
MIRT177720	hsa-miR-548ba	PAR-CLIP	20371350
MIRT177715	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT177716	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT177714	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT245480	hsa-miR-499a-5p	PAR-CLIP	20371350
MIRT262975	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT539399	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT539400	hsa-miR-205-3p	PAR-CLIP	22012620
MIRT539397	hsa-miR-1279	PAR-CLIP	22012620
MIRT539398	hsa-miR-3145-3p	PAR-CLIP	22012620
MIRT539396	hsa-miR-3140-3p	PAR-CLIP	22012620
MIRT539395	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT539394	hsa-miR-8055	PAR-CLIP	22012620
MIRT488037	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT488036	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT488035	hsa-miR-4310	PAR-CLIP	23592263
MIRT488033	hsa-miR-7157-5p	PAR-CLIP	23592263
MIRT488034	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT488032	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT488031	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT488030	hsa-miR-6077	PAR-CLIP	23592263
MIRT488029	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT488028	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT488027	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT488026	hsa-miR-4271	PAR-CLIP	23592263
MIRT488025	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT488023	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT488024	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT689081	hsa-miR-552-3p	HITS-CLIP	23313552
MIRT689080	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT689079	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT689078	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT689077	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT689075	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT689076	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT689074	hsa-miR-5095	HITS-CLIP	23313552
MIRT689073	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT689072	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT639004	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT639003	hsa-miR-764	HITS-CLIP	23824327
MIRT639002	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT639001	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT639000	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT638999	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT638998	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT638997	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT638996	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT638995	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT638994	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT367537	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT615553	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT615553	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT613883	hsa-miR-495-5p	HITS-CLIP	23824327
MIRT613882	hsa-miR-382-5p	HITS-CLIP	23824327
MIRT613881	hsa-miR-496	HITS-CLIP	23824327
MIRT177711	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT177712	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT177710	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT177713	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT177709	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT568590	hsa-miR-4432	PAR-CLIP	20371350
MIRT568591	hsa-miR-8087	PAR-CLIP	20371350
MIRT177718	hsa-miR-548ag	PAR-CLIP	20371350
MIRT177719	hsa-miR-548ai	PAR-CLIP	20371350
MIRT177720	hsa-miR-548ba	PAR-CLIP	20371350
MIRT177715	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT177716	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT177714	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT245480	hsa-miR-499a-5p	PAR-CLIP	20371350
MIRT262975	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT539399	hsa-miR-4760-3p	PAR-CLIP	22012620
MIRT539400	hsa-miR-205-3p	PAR-CLIP	22012620
MIRT539397	hsa-miR-1279	PAR-CLIP	22012620
MIRT539398	hsa-miR-3145-3p	PAR-CLIP	22012620
MIRT539396	hsa-miR-3140-3p	PAR-CLIP	22012620
MIRT539395	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT539394	hsa-miR-8055	PAR-CLIP	22012620
MIRT488037	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT488036	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT488035	hsa-miR-4310	PAR-CLIP	23592263
MIRT488033	hsa-miR-7157-5p	PAR-CLIP	23592263
MIRT488034	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT488032	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT488031	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT488030	hsa-miR-6077	PAR-CLIP	23592263
MIRT488029	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT488028	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT488027	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT488026	hsa-miR-4271	PAR-CLIP	23592263
MIRT488025	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT488023	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT488024	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT769479	hsa-miR-1202	CLIP-seq
MIRT769480	hsa-miR-1207-3p	CLIP-seq
MIRT769481	hsa-miR-1255a	CLIP-seq
MIRT769482	hsa-miR-1255b	CLIP-seq
MIRT769483	hsa-miR-1285	CLIP-seq
MIRT769484	hsa-miR-1292	CLIP-seq
MIRT769485	hsa-miR-132	CLIP-seq
MIRT769486	hsa-miR-1321	CLIP-seq
MIRT769487	hsa-miR-137	CLIP-seq
MIRT769488	hsa-miR-141	CLIP-seq
MIRT769489	hsa-miR-153	CLIP-seq
MIRT769490	hsa-miR-1913	CLIP-seq
MIRT769491	hsa-miR-197	CLIP-seq
MIRT769492	hsa-miR-200a	CLIP-seq
MIRT769493	hsa-miR-2114	CLIP-seq
MIRT769494	hsa-miR-212	CLIP-seq
MIRT769495	hsa-miR-218	CLIP-seq
MIRT769496	hsa-miR-2355-3p	CLIP-seq
MIRT769497	hsa-miR-25	CLIP-seq
MIRT769498	hsa-miR-3064-3p	CLIP-seq
MIRT769499	hsa-miR-30a	CLIP-seq
MIRT769500	hsa-miR-30b	CLIP-seq
MIRT769501	hsa-miR-30c	CLIP-seq
MIRT769502	hsa-miR-30d	CLIP-seq
MIRT769503	hsa-miR-30e	CLIP-seq
MIRT769504	hsa-miR-3129-3p	CLIP-seq
MIRT769505	hsa-miR-3130-3p	CLIP-seq
MIRT769506	hsa-miR-3158-3p	CLIP-seq
MIRT769507	hsa-miR-3162-5p	CLIP-seq
MIRT769508	hsa-miR-3187-5p	CLIP-seq
MIRT769509	hsa-miR-3189-5p	CLIP-seq
MIRT769510	hsa-miR-3194-5p	CLIP-seq
MIRT769511	hsa-miR-32	CLIP-seq
MIRT769512	hsa-miR-324-3p	CLIP-seq
MIRT769513	hsa-miR-331-3p	CLIP-seq
MIRT769514	hsa-miR-335	CLIP-seq
MIRT769515	hsa-miR-33a	CLIP-seq
MIRT769516	hsa-miR-33b	CLIP-seq
MIRT769517	hsa-miR-3609	CLIP-seq
MIRT769518	hsa-miR-3614-5p	CLIP-seq
MIRT769519	hsa-miR-3620	CLIP-seq
MIRT769520	hsa-miR-363	CLIP-seq
MIRT769521	hsa-miR-3655	CLIP-seq
MIRT769522	hsa-miR-367	CLIP-seq
MIRT769523	hsa-miR-3909	CLIP-seq
MIRT769524	hsa-miR-3936	CLIP-seq
MIRT769525	hsa-miR-3972	CLIP-seq
MIRT769526	hsa-miR-4252	CLIP-seq
MIRT769527	hsa-miR-4289	CLIP-seq
MIRT769528	hsa-miR-4300	CLIP-seq
MIRT769529	hsa-miR-4469	CLIP-seq
MIRT769530	hsa-miR-4471	CLIP-seq
MIRT769531	hsa-miR-4474-3p	CLIP-seq
MIRT769532	hsa-miR-4474-5p	CLIP-seq
MIRT769533	hsa-miR-4481	CLIP-seq
MIRT769534	hsa-miR-4646-5p	CLIP-seq
MIRT769535	hsa-miR-4662a-3p	CLIP-seq
MIRT769536	hsa-miR-4666-5p	CLIP-seq
MIRT769537	hsa-miR-4691-5p	CLIP-seq
MIRT769538	hsa-miR-4696	CLIP-seq
MIRT769539	hsa-miR-4705	CLIP-seq
MIRT769540	hsa-miR-4715-3p	CLIP-seq
MIRT769541	hsa-miR-4721	CLIP-seq
MIRT769542	hsa-miR-4729	CLIP-seq
MIRT769543	hsa-miR-4739	CLIP-seq
MIRT769544	hsa-miR-4745-5p	CLIP-seq
MIRT769545	hsa-miR-4756-5p	CLIP-seq
MIRT769546	hsa-miR-4758-3p	CLIP-seq
MIRT769547	hsa-miR-4785	CLIP-seq
MIRT769548	hsa-miR-4793-3p	CLIP-seq
MIRT769549	hsa-miR-4795-3p	CLIP-seq
MIRT769550	hsa-miR-4803	CLIP-seq
MIRT769551	hsa-miR-491-3p	CLIP-seq
MIRT769552	hsa-miR-494	CLIP-seq
MIRT769553	hsa-miR-499-5p	CLIP-seq
MIRT769554	hsa-miR-501-3p	CLIP-seq
MIRT769555	hsa-miR-502-3p	CLIP-seq
MIRT769556	hsa-miR-522	CLIP-seq
MIRT769557	hsa-miR-544	CLIP-seq
MIRT769558	hsa-miR-548ah	CLIP-seq
MIRT769559	hsa-miR-548n	CLIP-seq
MIRT769560	hsa-miR-548t	CLIP-seq
MIRT769561	hsa-miR-552	CLIP-seq
MIRT769562	hsa-miR-556-3p	CLIP-seq
MIRT769563	hsa-miR-561	CLIP-seq
MIRT769564	hsa-miR-612	CLIP-seq
MIRT769565	hsa-miR-624	CLIP-seq
MIRT769566	hsa-miR-635	CLIP-seq
MIRT769567	hsa-miR-676	CLIP-seq
MIRT769568	hsa-miR-767-5p	CLIP-seq
MIRT769569	hsa-miR-889	CLIP-seq
MIRT769570	hsa-miR-920	CLIP-seq
MIRT769571	hsa-miR-92a	CLIP-seq
MIRT769572	hsa-miR-92b	CLIP-seq
MIRT769573	hsa-miR-944	CLIP-seq
MIRT1545167	hsa-miR-767-3p	CLIP-seq
MIRT769486	hsa-miR-1321	CLIP-seq
MIRT769491	hsa-miR-197	CLIP-seq
MIRT1926999	hsa-miR-2110	CLIP-seq
MIRT769495	hsa-miR-218	CLIP-seq
MIRT1927000	hsa-miR-3124-3p	CLIP-seq
MIRT1927001	hsa-miR-3125	CLIP-seq
MIRT769507	hsa-miR-3162-5p	CLIP-seq
MIRT1927002	hsa-miR-338-5p	CLIP-seq
MIRT769515	hsa-miR-33a	CLIP-seq
MIRT769516	hsa-miR-33b	CLIP-seq
MIRT1927003	hsa-miR-3689a-3p	CLIP-seq
MIRT1927004	hsa-miR-3689c	CLIP-seq
MIRT1927005	hsa-miR-3916	CLIP-seq
MIRT1927006	hsa-miR-4259	CLIP-seq
MIRT1927007	hsa-miR-4261	CLIP-seq
MIRT769527	hsa-miR-4289	CLIP-seq
MIRT1927008	hsa-miR-4425	CLIP-seq
MIRT1927009	hsa-miR-4433	CLIP-seq
MIRT1927010	hsa-miR-4436b-5p	CLIP-seq
MIRT1927011	hsa-miR-4459	CLIP-seq
MIRT769532	hsa-miR-4474-5p	CLIP-seq
MIRT1927012	hsa-miR-4476	CLIP-seq
MIRT1927013	hsa-miR-4477a	CLIP-seq
MIRT769533	hsa-miR-4481	CLIP-seq
MIRT1927014	hsa-miR-4496	CLIP-seq
MIRT1927015	hsa-miR-451b	CLIP-seq
MIRT769538	hsa-miR-4696	CLIP-seq
MIRT1927016	hsa-miR-4733-5p	CLIP-seq
MIRT769543	hsa-miR-4739	CLIP-seq
MIRT769544	hsa-miR-4745-5p	CLIP-seq
MIRT1927017	hsa-miR-4747-5p	CLIP-seq
MIRT769545	hsa-miR-4756-5p	CLIP-seq
MIRT1927018	hsa-miR-4768-3p	CLIP-seq
MIRT1927019	hsa-miR-511	CLIP-seq
MIRT769556	hsa-miR-522	CLIP-seq
MIRT1927020	hsa-miR-543	CLIP-seq
MIRT1927021	hsa-miR-548p	CLIP-seq
MIRT1927022	hsa-miR-568	CLIP-seq
MIRT1927023	hsa-miR-571	CLIP-seq
MIRT1927024	hsa-miR-579	CLIP-seq
MIRT2167839	hsa-miR-101	CLIP-seq
MIRT2167840	hsa-miR-1185	CLIP-seq
MIRT769479	hsa-miR-1202	CLIP-seq
MIRT769480	hsa-miR-1207-3p	CLIP-seq
MIRT2167841	hsa-miR-1238	CLIP-seq
MIRT2167842	hsa-miR-1286	CLIP-seq
MIRT2167843	hsa-miR-1294	CLIP-seq
MIRT769486	hsa-miR-1321	CLIP-seq
MIRT769488	hsa-miR-141	CLIP-seq
MIRT2167844	hsa-miR-181a	CLIP-seq
MIRT2167845	hsa-miR-181b	CLIP-seq
MIRT2167846	hsa-miR-181c	CLIP-seq
MIRT2167847	hsa-miR-181d	CLIP-seq
MIRT769492	hsa-miR-200a	CLIP-seq
MIRT2167848	hsa-miR-24	CLIP-seq
MIRT2167849	hsa-miR-2909	CLIP-seq
MIRT2167850	hsa-miR-296-3p	CLIP-seq
MIRT769499	hsa-miR-30a	CLIP-seq
MIRT769500	hsa-miR-30b	CLIP-seq
MIRT769501	hsa-miR-30c	CLIP-seq
MIRT769502	hsa-miR-30d	CLIP-seq
MIRT769503	hsa-miR-30e	CLIP-seq
MIRT1927000	hsa-miR-3124-3p	CLIP-seq
MIRT769505	hsa-miR-3130-3p	CLIP-seq
MIRT769507	hsa-miR-3162-5p	CLIP-seq
MIRT769510	hsa-miR-3194-5p	CLIP-seq
MIRT769515	hsa-miR-33a	CLIP-seq
MIRT769516	hsa-miR-33b	CLIP-seq
MIRT2167851	hsa-miR-3605-5p	CLIP-seq
MIRT2167852	hsa-miR-3607-5p	CLIP-seq
MIRT2167853	hsa-miR-3672	CLIP-seq
MIRT2167854	hsa-miR-3679-5p	CLIP-seq
MIRT1927003	hsa-miR-3689a-3p	CLIP-seq
MIRT1927004	hsa-miR-3689c	CLIP-seq
MIRT2167855	hsa-miR-369-3p	CLIP-seq
MIRT2167856	hsa-miR-374a	CLIP-seq
MIRT2167857	hsa-miR-374b	CLIP-seq
MIRT2167858	hsa-miR-374c	CLIP-seq
MIRT2167859	hsa-miR-3917	CLIP-seq
MIRT769525	hsa-miR-3972	CLIP-seq
MIRT2167860	hsa-miR-423-3p	CLIP-seq
MIRT1927006	hsa-miR-4259	CLIP-seq
MIRT2167861	hsa-miR-4262	CLIP-seq
MIRT2167862	hsa-miR-4284	CLIP-seq
MIRT2167863	hsa-miR-4316	CLIP-seq
MIRT1927008	hsa-miR-4425	CLIP-seq
MIRT1927009	hsa-miR-4433	CLIP-seq
MIRT1927010	hsa-miR-4436b-5p	CLIP-seq
MIRT1927011	hsa-miR-4459	CLIP-seq
MIRT1927013	hsa-miR-4477a	CLIP-seq
MIRT1927015	hsa-miR-451b	CLIP-seq
MIRT2167864	hsa-miR-4633-5p	CLIP-seq
MIRT2167865	hsa-miR-4645-3p	CLIP-seq
MIRT769535	hsa-miR-4662a-3p	CLIP-seq
MIRT769536	hsa-miR-4666-5p	CLIP-seq
MIRT2167866	hsa-miR-4679	CLIP-seq
MIRT769538	hsa-miR-4696	CLIP-seq
MIRT2167867	hsa-miR-4722-5p	CLIP-seq
MIRT769543	hsa-miR-4739	CLIP-seq
MIRT769545	hsa-miR-4756-5p	CLIP-seq
MIRT1927018	hsa-miR-4768-3p	CLIP-seq
MIRT769547	hsa-miR-4785	CLIP-seq
MIRT769548	hsa-miR-4793-3p	CLIP-seq
MIRT769553	hsa-miR-499-5p	CLIP-seq
MIRT2167868	hsa-miR-505	CLIP-seq
MIRT769556	hsa-miR-522	CLIP-seq
MIRT2167869	hsa-miR-532-5p	CLIP-seq
MIRT2167870	hsa-miR-542-3p	CLIP-seq
MIRT1927020	hsa-miR-543	CLIP-seq
MIRT769557	hsa-miR-544	CLIP-seq
MIRT2167871	hsa-miR-548a-3p	CLIP-seq
MIRT2167872	hsa-miR-548e	CLIP-seq
MIRT2167873	hsa-miR-548f	CLIP-seq
MIRT1927023	hsa-miR-571	CLIP-seq
MIRT1927024	hsa-miR-579	CLIP-seq
MIRT2167874	hsa-miR-592	CLIP-seq
MIRT2167875	hsa-miR-597	CLIP-seq
MIRT769565	hsa-miR-624	CLIP-seq
MIRT2167876	hsa-miR-655	CLIP-seq
MIRT2167877	hsa-miR-671-5p	CLIP-seq
MIRT769568	hsa-miR-767-5p	CLIP-seq
MIRT1926999	hsa-miR-2110	CLIP-seq
MIRT1927001	hsa-miR-3125	CLIP-seq
MIRT2443275	hsa-miR-3149	CLIP-seq
MIRT1927005	hsa-miR-3916	CLIP-seq
MIRT1927022	hsa-miR-568	CLIP-seq
MIRT2167841	hsa-miR-1238	CLIP-seq
MIRT2167848	hsa-miR-24	CLIP-seq
MIRT1927000	hsa-miR-3124-3p	CLIP-seq
MIRT2470433	hsa-miR-3613-3p	CLIP-seq
MIRT2167862	hsa-miR-4284	CLIP-seq
MIRT2470434	hsa-miR-4501	CLIP-seq
MIRT2470435	hsa-miR-548l	CLIP-seq
MIRT769559	hsa-miR-548n	CLIP-seq
MIRT2674606	hsa-miR-1208	CLIP-seq
MIRT769491	hsa-miR-197	CLIP-seq
MIRT2674607	hsa-miR-2116	CLIP-seq
MIRT2674608	hsa-miR-3545-3p	CLIP-seq
MIRT2674609	hsa-miR-3606	CLIP-seq
MIRT2674610	hsa-miR-412	CLIP-seq
MIRT2674611	hsa-miR-4420	CLIP-seq
MIRT2674612	hsa-miR-4677-5p	CLIP-seq
MIRT2674613	hsa-miR-4699-3p	CLIP-seq
MIRT2674614	hsa-miR-4735-5p	CLIP-seq
MIRT2674615	hsa-miR-510	CLIP-seq
MIRT1927019	hsa-miR-511	CLIP-seq
MIRT2674616	hsa-miR-512-5p	CLIP-seq
MIRT769563	hsa-miR-561	CLIP-seq
MIRT2674617	hsa-miR-921	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IDA	34508780
GO:0005506	Function	Iron ion binding	IEA
GO:0005506	Function	Iron ion binding	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	TAS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047800	Function	Cysteamine dioxygenase activity	IDA	31273118, 32601061
GO:0047800	Function	Cysteamine dioxygenase activity	IEA
GO:0047800	Function	Cysteamine dioxygenase activity	IMP	17581819, 29752763
GO:0051213	Function	Dioxygenase activity	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	31273118

Other IDs

• MIM: 611392
• HGNC: 23506
• e!Ensembl: ENSG00000181915

Protein

• UniProt ID: Q96SZ5
• Protein name: 2-aminoethanethiol dioxygenase (EC 1.13.11.19) (Cysteamine dioxygenase)
• Protein function: Plays a vital role in regulating thiol metabolism and preserving oxygen homeostasis by oxidizing the sulfur of cysteamine and N-terminal cysteine-containing proteins to their corresponding sulfinic acids using O2 as a cosubstrate (PubMed:1758181
• PDB: 7REI, 8U9J, 8UAN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07847	PCO_ADO	57 → 268	PCO_ADO	Family

• Sequence:

  MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQ
  LRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGM
  LKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEAS
  GPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACD
  LPREVWLLETPQADDFWCEGEPYPGPKVFP

• Sequence length: 270

Pathways

KEGG:

Taurine and hypotaurine metabolism
Metabolic pathways

Reactome:

Degradation of cysteine and homocysteine

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33098857	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	27898501		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29907633		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	29907633, 33393726	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	24336069, 26056022		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26073781	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	19773399		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30301599		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30301599		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29495970, 29724388, 31665736, 31749613		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19342675		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24130123		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31751583		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33069716, 33901562	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31751583		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27516058		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28439920		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30301599		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31623146		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39278925	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19773399, 29776993		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28439920		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26073781		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	10617161, 11741829, 12662317, 20830208, 21962762		★☆☆☆☆ Found in Text Mining only
Osteosclerosis	Osteosclerosis	BEFREE	26056022		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33069716	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27516058		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15580654		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	31669406		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	25108386, 26628628		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	32437414	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	24130123		★☆☆☆☆ Found in Text Mining only