SPPL2A (signal peptide peptidase like 2A)

Gene

• Entrez ID: 84888
• Gene name: Signal peptide peptidase like 2A
• Gene symbol: SPPL2A
• Synonyms (NCBI Gene): IMD86, IMP3, PSL2
• Chromosome: 15
• Chromosome location: 15q21.2
• Summary: This gene encodes a member of the GXGD family of aspartic proteases, which are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions, as well as a member of the signal peptide peptidase-like protease (SP

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT398430	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707563	hsa-miR-5000-5p	HITS-CLIP	21572407
MIRT510709	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510708	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707562	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT510707	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT698913	hsa-miR-551b-5p	HITS-CLIP	23313552
MIRT698912	hsa-miR-425-5p	HITS-CLIP	23313552
MIRT698911	hsa-miR-4528	HITS-CLIP	23313552
MIRT698910	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT698909	hsa-miR-642a-3p	HITS-CLIP	23313552
MIRT698908	hsa-miR-642b-3p	HITS-CLIP	23313552
MIRT698907	hsa-miR-3674	HITS-CLIP	23313552
MIRT510707	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT398430	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT510709	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT510708	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT673833	hsa-miR-4284	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673832	hsa-miR-7977	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673838	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT673837	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT673836	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT673835	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT673834	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT673833	hsa-miR-4284	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673832	hsa-miR-7977	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT398430	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT510709	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT510708	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510707	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT520975	hsa-miR-302f	PAR-CLIP	21572407
MIRT520974	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT520973	hsa-miR-4459	PAR-CLIP	21572407
MIRT520972	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT520971	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT520970	hsa-miR-5091	PAR-CLIP	21572407
MIRT520969	hsa-miR-5739	PAR-CLIP	21572407
MIRT520968	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT554010	hsa-miR-5702	PAR-CLIP	21572407
MIRT520967	hsa-miR-4785	PAR-CLIP	21572407
MIRT554009	hsa-miR-937-5p	PAR-CLIP	21572407
MIRT520966	hsa-miR-1273e	PAR-CLIP	21572407
MIRT501012	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT501011	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT501010	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT501009	hsa-miR-223-3p	PAR-CLIP	21572407
MIRT501008	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT501007	hsa-miR-548ab	PAR-CLIP	21572407
MIRT501006	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT501005	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT501004	hsa-miR-548ak	PAR-CLIP	21572407
MIRT501003	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT501002	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT501001	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT501000	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT500999	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT500998	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT500997	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT500996	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT500995	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT500994	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT500993	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT500992	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT500991	hsa-miR-548i	PAR-CLIP	21572407
MIRT500990	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT500989	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT500988	hsa-miR-548w	PAR-CLIP	21572407
MIRT500987	hsa-miR-548y	PAR-CLIP	21572407
MIRT500986	hsa-miR-559	PAR-CLIP	21572407
MIRT500985	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT500984	hsa-miR-548k	PAR-CLIP	21572407
MIRT500982	hsa-miR-8054	PAR-CLIP	21572407
MIRT500983	hsa-miR-548l	PAR-CLIP	21572407
MIRT500981	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT500980	hsa-miR-1278	PAR-CLIP	21572407
MIRT500979	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT500977	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT500978	hsa-miR-16-1-3p	PAR-CLIP	21572407
MIRT500976	hsa-miR-3655	PAR-CLIP	21572407
MIRT500975	hsa-miR-4697-3p	PAR-CLIP	21572407
MIRT520975	hsa-miR-302f	PAR-CLIP	23446348
MIRT520974	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT520973	hsa-miR-4459	PAR-CLIP	23446348
MIRT520972	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT520971	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT520970	hsa-miR-5091	PAR-CLIP	23446348
MIRT520969	hsa-miR-5739	PAR-CLIP	23446348
MIRT520968	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT520967	hsa-miR-4785	PAR-CLIP	23446348
MIRT520966	hsa-miR-1273e	PAR-CLIP	23446348
MIRT398430	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT510709	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510708	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510707	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT501012	hsa-miR-1271-5p	PAR-CLIP	24398324
MIRT501011	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT501010	hsa-miR-96-5p	PAR-CLIP	24398324
MIRT501009	hsa-miR-223-3p	PAR-CLIP	24398324
MIRT501008	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT501007	hsa-miR-548ab	PAR-CLIP	24398324
MIRT501006	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT501005	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT501004	hsa-miR-548ak	PAR-CLIP	24398324
MIRT501003	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT501002	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT501001	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT501000	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT500999	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT500998	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT500997	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT500996	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT500995	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT500994	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT500993	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT500992	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT500991	hsa-miR-548i	PAR-CLIP	24398324
MIRT500990	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT500989	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT500988	hsa-miR-548w	PAR-CLIP	24398324
MIRT500987	hsa-miR-548y	PAR-CLIP	24398324
MIRT500986	hsa-miR-559	PAR-CLIP	24398324
MIRT500985	hsa-miR-548av-5p	PAR-CLIP	24398324
MIRT500984	hsa-miR-548k	PAR-CLIP	24398324
MIRT500982	hsa-miR-8054	PAR-CLIP	24398324
MIRT500983	hsa-miR-548l	PAR-CLIP	24398324
MIRT500981	hsa-miR-580-5p	PAR-CLIP	24398324
MIRT500980	hsa-miR-1278	PAR-CLIP	24398324
MIRT500979	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT500977	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT500978	hsa-miR-16-1-3p	PAR-CLIP	24398324
MIRT500976	hsa-miR-3655	PAR-CLIP	24398324
MIRT500975	hsa-miR-4697-3p	PAR-CLIP	24398324
MIRT467264	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT467263	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT467262	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT467261	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT467260	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT467259	hsa-miR-940	PAR-CLIP	23592263
MIRT467258	hsa-miR-3174	PAR-CLIP	23592263
MIRT467257	hsa-miR-4257	PAR-CLIP	23592263
MIRT467256	hsa-miR-665	PAR-CLIP	23592263
MIRT467255	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT467254	hsa-miR-1827	PAR-CLIP	23592263
MIRT467253	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT467252	hsa-miR-6086	PAR-CLIP	23592263
MIRT467251	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT467250	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT467249	hsa-miR-3612	PAR-CLIP	23592263
MIRT467248	hsa-miR-650	PAR-CLIP	23592263
MIRT467247	hsa-miR-6073	PAR-CLIP	23592263
MIRT467246	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT467245	hsa-miR-921	PAR-CLIP	23592263
MIRT467244	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT467243	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT398430	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT707563	hsa-miR-5000-5p	HITS-CLIP	21572407
MIRT510709	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510708	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707562	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT510707	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT698913	hsa-miR-551b-5p	HITS-CLIP	23313552
MIRT698912	hsa-miR-425-5p	HITS-CLIP	23313552
MIRT698911	hsa-miR-4528	HITS-CLIP	23313552
MIRT698910	hsa-miR-138-2-3p	HITS-CLIP	23313552
MIRT698909	hsa-miR-642a-3p	HITS-CLIP	23313552
MIRT698908	hsa-miR-642b-3p	HITS-CLIP	23313552
MIRT698907	hsa-miR-3674	HITS-CLIP	23313552
MIRT510707	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT398430	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT510709	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT510708	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT673833	hsa-miR-4284	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673832	hsa-miR-7977	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673838	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT673837	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT673836	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT673835	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT673834	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT673833	hsa-miR-4284	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT673832	hsa-miR-7977	HITS-CLIP	23824327
MIRT632036	hsa-miR-6499-5p	HITS-CLIP	23824327
MIRT632035	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT632034	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632033	hsa-miR-3178	HITS-CLIP	23824327
MIRT398430	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT510709	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT510708	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510707	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT520975	hsa-miR-302f	PAR-CLIP	21572407
MIRT520974	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT520973	hsa-miR-4459	PAR-CLIP	21572407
MIRT520972	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT520971	hsa-miR-1247-3p	PAR-CLIP	21572407
MIRT520970	hsa-miR-5091	PAR-CLIP	21572407
MIRT520969	hsa-miR-5739	PAR-CLIP	21572407
MIRT520968	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT554010	hsa-miR-5702	PAR-CLIP	21572407
MIRT520967	hsa-miR-4785	PAR-CLIP	21572407
MIRT554009	hsa-miR-937-5p	PAR-CLIP	21572407
MIRT520966	hsa-miR-1273e	PAR-CLIP	21572407
MIRT501012	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT501011	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT501010	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT501009	hsa-miR-223-3p	PAR-CLIP	21572407
MIRT501008	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT501007	hsa-miR-548ab	PAR-CLIP	21572407
MIRT501006	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT501005	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT501004	hsa-miR-548ak	PAR-CLIP	21572407
MIRT501003	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT501002	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT501001	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT501000	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT500999	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT500998	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT500997	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT500996	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT500995	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT500994	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT500993	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT500992	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT500991	hsa-miR-548i	PAR-CLIP	21572407
MIRT500990	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT500989	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT500988	hsa-miR-548w	PAR-CLIP	21572407
MIRT500987	hsa-miR-548y	PAR-CLIP	21572407
MIRT500986	hsa-miR-559	PAR-CLIP	21572407
MIRT500985	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT500984	hsa-miR-548k	PAR-CLIP	21572407
MIRT500982	hsa-miR-8054	PAR-CLIP	21572407
MIRT500983	hsa-miR-548l	PAR-CLIP	21572407
MIRT500981	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT500980	hsa-miR-1278	PAR-CLIP	21572407
MIRT500979	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT500977	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT500978	hsa-miR-16-1-3p	PAR-CLIP	21572407
MIRT500976	hsa-miR-3655	PAR-CLIP	21572407
MIRT500975	hsa-miR-4697-3p	PAR-CLIP	21572407
MIRT520975	hsa-miR-302f	PAR-CLIP	23446348
MIRT520974	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT520973	hsa-miR-4459	PAR-CLIP	23446348
MIRT520972	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT520971	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT520970	hsa-miR-5091	PAR-CLIP	23446348
MIRT520969	hsa-miR-5739	PAR-CLIP	23446348
MIRT520968	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT520967	hsa-miR-4785	PAR-CLIP	23446348
MIRT520966	hsa-miR-1273e	PAR-CLIP	23446348
MIRT398430	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT510709	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510708	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510707	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT501012	hsa-miR-1271-5p	PAR-CLIP	24398324
MIRT501011	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT501010	hsa-miR-96-5p	PAR-CLIP	24398324
MIRT501009	hsa-miR-223-3p	PAR-CLIP	24398324
MIRT501008	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT501007	hsa-miR-548ab	PAR-CLIP	24398324
MIRT501006	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT501005	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT501004	hsa-miR-548ak	PAR-CLIP	24398324
MIRT501003	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT501002	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT501001	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT501000	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT500999	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT500998	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT500997	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT500996	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT500995	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT500994	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT500993	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT500992	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT500991	hsa-miR-548i	PAR-CLIP	24398324
MIRT500990	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT500989	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT500988	hsa-miR-548w	PAR-CLIP	24398324
MIRT500987	hsa-miR-548y	PAR-CLIP	24398324
MIRT500986	hsa-miR-559	PAR-CLIP	24398324
MIRT500985	hsa-miR-548av-5p	PAR-CLIP	24398324
MIRT500984	hsa-miR-548k	PAR-CLIP	24398324
MIRT500982	hsa-miR-8054	PAR-CLIP	24398324
MIRT500983	hsa-miR-548l	PAR-CLIP	24398324
MIRT500981	hsa-miR-580-5p	PAR-CLIP	24398324
MIRT500980	hsa-miR-1278	PAR-CLIP	24398324
MIRT500979	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT500977	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT500978	hsa-miR-16-1-3p	PAR-CLIP	24398324
MIRT500976	hsa-miR-3655	PAR-CLIP	24398324
MIRT500975	hsa-miR-4697-3p	PAR-CLIP	24398324
MIRT467264	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT467263	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT467262	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT467261	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT467260	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT467259	hsa-miR-940	PAR-CLIP	23592263
MIRT467258	hsa-miR-3174	PAR-CLIP	23592263
MIRT467257	hsa-miR-4257	PAR-CLIP	23592263
MIRT467256	hsa-miR-665	PAR-CLIP	23592263
MIRT467255	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT467254	hsa-miR-1827	PAR-CLIP	23592263
MIRT467253	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT467252	hsa-miR-6086	PAR-CLIP	23592263
MIRT467251	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT467250	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT467249	hsa-miR-3612	PAR-CLIP	23592263
MIRT467248	hsa-miR-650	PAR-CLIP	23592263
MIRT467247	hsa-miR-6073	PAR-CLIP	23592263
MIRT467246	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT467245	hsa-miR-921	PAR-CLIP	23592263
MIRT467244	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT467243	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT1385445	hsa-miR-124	CLIP-seq
MIRT1385446	hsa-miR-1272	CLIP-seq
MIRT1385447	hsa-miR-1322	CLIP-seq
MIRT1385448	hsa-miR-219-5p	CLIP-seq
MIRT1385449	hsa-miR-223	CLIP-seq
MIRT1385450	hsa-miR-3171	CLIP-seq
MIRT1385451	hsa-miR-3611	CLIP-seq
MIRT1385452	hsa-miR-3917	CLIP-seq
MIRT1385453	hsa-miR-3942-3p	CLIP-seq
MIRT1385454	hsa-miR-425	CLIP-seq
MIRT1385455	hsa-miR-4267	CLIP-seq
MIRT1385456	hsa-miR-4274	CLIP-seq
MIRT1385457	hsa-miR-4307	CLIP-seq
MIRT1385458	hsa-miR-4432	CLIP-seq
MIRT1385459	hsa-miR-4493	CLIP-seq
MIRT1385460	hsa-miR-4519	CLIP-seq
MIRT1385461	hsa-miR-4672	CLIP-seq
MIRT1385462	hsa-miR-4709-3p	CLIP-seq
MIRT1385463	hsa-miR-4782-3p	CLIP-seq
MIRT1385464	hsa-miR-506	CLIP-seq
MIRT1385465	hsa-miR-634	CLIP-seq
MIRT1385466	hsa-miR-642b	CLIP-seq
MIRT1554112	hsa-miR-3143	CLIP-seq
MIRT1554113	hsa-miR-543	CLIP-seq
MIRT1385445	hsa-miR-124	CLIP-seq
MIRT2115324	hsa-miR-129-5p	CLIP-seq
MIRT1385448	hsa-miR-219-5p	CLIP-seq
MIRT1554112	hsa-miR-3143	CLIP-seq
MIRT1385451	hsa-miR-3611	CLIP-seq
MIRT2115325	hsa-miR-3692	CLIP-seq
MIRT1385452	hsa-miR-3917	CLIP-seq
MIRT1385453	hsa-miR-3942-3p	CLIP-seq
MIRT1385455	hsa-miR-4267	CLIP-seq
MIRT1385456	hsa-miR-4274	CLIP-seq
MIRT1385457	hsa-miR-4307	CLIP-seq
MIRT1385458	hsa-miR-4432	CLIP-seq
MIRT1385459	hsa-miR-4493	CLIP-seq
MIRT2115326	hsa-miR-450b-5p	CLIP-seq
MIRT1385460	hsa-miR-4519	CLIP-seq
MIRT1385461	hsa-miR-4672	CLIP-seq
MIRT1385462	hsa-miR-4709-3p	CLIP-seq
MIRT1385463	hsa-miR-4782-3p	CLIP-seq
MIRT1385464	hsa-miR-506	CLIP-seq
MIRT2115327	hsa-miR-507	CLIP-seq
MIRT1554113	hsa-miR-543	CLIP-seq
MIRT2115328	hsa-miR-548c-3p	CLIP-seq
MIRT2115329	hsa-miR-557	CLIP-seq
MIRT1385465	hsa-miR-634	CLIP-seq
MIRT1385466	hsa-miR-642b	CLIP-seq
MIRT1385446	hsa-miR-1272	CLIP-seq
MIRT1385447	hsa-miR-1322	CLIP-seq
MIRT1385449	hsa-miR-223	CLIP-seq
MIRT1385450	hsa-miR-3171	CLIP-seq
MIRT2115325	hsa-miR-3692	CLIP-seq
MIRT1385452	hsa-miR-3917	CLIP-seq
MIRT1385456	hsa-miR-4274	CLIP-seq
MIRT1385460	hsa-miR-4519	CLIP-seq
MIRT1385461	hsa-miR-4672	CLIP-seq
MIRT1385466	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17965014, 25416956, 32296183, 32814053
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IDA	16829952
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IDA	16829951, 17965014
GO:0008233	Function	Peptidase activity	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016020	Component	Membrane	IDA	2313285
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030660	Component	Golgi-associated vesicle membrane	IBA
GO:0030660	Component	Golgi-associated vesicle membrane	IDA	17965014
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IDA	16829951, 17557115
GO:0031293	Process	Membrane protein intracellular domain proteolysis	IMP	16829952
GO:0031902	Component	Late endosome membrane	IEA
GO:0033619	Process	Membrane protein proteolysis	IBA
GO:0033619	Process	Membrane protein proteolysis	IDA	2313285
GO:0033619	Process	Membrane protein proteolysis	IEA
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	IBA
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	IDA	2313285
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	IEA
GO:0042500	Function	Aspartic endopeptidase activity, intramembrane cleaving	TAS
GO:0042803	Function	Protein homodimerization activity	IDA	15385547
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0050776	Process	Regulation of immune response	IMP	16829952
GO:0050776	Process	Regulation of immune response	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IBA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IDA	15385547
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IEA
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IBA
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IDA	15385547
GO:0098554	Component	Cytoplasmic side of endoplasmic reticulum membrane	IEA
GO:0098588	Component	Bounding membrane of organelle	IEA

Other IDs

• MIM: 608238
• HGNC: 30227
• e!Ensembl: ENSG00000138600

Protein

• UniProt ID: Q8TCT8
• Protein name: Signal peptide peptidase-like 2A (SPP-like 2A) (SPPL2a) (EC 3.4.23.-) (Intramembrane protease 3) (IMP-3) (Presenilin-like protein 2)
• Protein function: Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane. Functions in FASLG, ITM2B and TNF processing (PubMed:16829951, PubMed:16829952, PubMed:17557115, PubMed:179
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02225	PA	52 → 148	PA domain	Family
  PF04258	Peptidase_A22B	210 → 496	Signal peptide peptidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15385547}.
• Sequence:

  MGPQRRLSPAGAALLWGFLLQLTAAQEAILHASGNGTTKDYCMLYNPYWTALPSTLENAT
  SISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVL
  FPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAV
  FTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFF
  YKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVA
  VVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPF
  ITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLI
  AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVA
  WRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ

• Sequence length: 520

Pathways

Reactome:

Regulation of TNFR1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 86	Pathogenic	rs1328617979, rs2141024987	RCV001728165 RCV001728166	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPPL2A-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	25337222, 29115542, 29209838, 30946937		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	19357927		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25337222, 26608347		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28412210, 28804555		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33152005	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	24162737		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	24162737		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25886367		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18369459, 34079550	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21613208		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23584203, 25521223	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18369459, 25035924, 33152005	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25035924, 28731783, 29359565		★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	32273198	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24615121		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	18260086	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23246869	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23539627, 26390986, 29771420, 29847788		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22266872, 23539627, 25031719, 25982283, 29847788	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17885673, 21809994, 25014991, 25038792, 36740684	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25380351	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	25144243	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28179304, 29866423, 30031101, 30921622		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23702728	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	17885673	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23549465, 25014991, 25038792	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	31256008		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26158423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22646265, 24439226, 25886367, 27839709, 32273198	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18260086, 18412154, 23465280, 25919292, 26837693	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36740684	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25144243	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23549465, 23923073, 26782292	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33680717	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	29146055		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21997684		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23246869, 24439226, 24745619	Associate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30650187		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28412210		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26617820	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30650187		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17885673, 39176196	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18452554	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	21809994	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	33152005	Associate	★☆☆☆☆ Found in Text Mining only
Glandular Neoplasms	Glandular Neoplasms	BEFREE	23904388		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21613208, 25695077		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25695077	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21613208		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25695077		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25695077, 28485999	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	18369459	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	32293476	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27137988	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36577979	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24745619		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	BEFREE	27717885		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15753088	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26342105		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24647926		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17784873	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28210937		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24745619, 26617820	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	26729015, 30031101		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23539627, 29771420, 29847788		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29163784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24615121		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22012575, 29115542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29115542		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19357927, 23226335, 23539627, 23812426, 24615121, 24703842, 24713990, 24745619, 25038792, 25982283, 26826410, 28804555, 29115542, 29209838, 29771420, 31256008, 31277094		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	29115542		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25982283		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18204432, 19788446, 20520718, 25380351, 26796627	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20483645		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21809995	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31218705		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	23473990	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25919292	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15753088, 19357927, 21613208, 22012575, 22042095, 22266872, 23584203, 24615121, 24713990, 24745619, 25982283, 26390986, 26943575, 28210937, 28804555, 29115542, 29146055, 29771420, 30650187, 30921622		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21917080, 29115542	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29115542		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29209838		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	27497264	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22042095, 23226335		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29866423	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	BEFREE	28804555		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19136932, 23465280, 26158423, 26837693	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25886367		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25886367, 27839709	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	23584203		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24615121		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20591150	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30650187		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26943575	Stimulate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	29115542	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32198923	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	26390986		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21997684, 29115542		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31656650		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22012575		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	22012575		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24966917	Associate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	26826410		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	29115542	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20562850		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20562850	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22266872, 23539627, 25982283, 28756977, 29217458, 29771420		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22266872, 23539627, 25982283, 32049813, 40058835	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18347170, 21469424, 29115542	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	31277094		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23923073	Associate	★☆☆☆☆ Found in Text Mining only