Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84870
Gene name	R-spondin 3
Gene symbol	RSPO3
Synonyms (NCBI Gene)	CRISTIN1PWTSRTHSD2
Chromosome	6
Chromosome location	6q22.33
Summary	This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell g

146

Show/Hide all (146)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017040	hsa-miR-335-5p	Microarray	18185580
MIRT1321411	hsa-miR-3163	CLIP-seq
MIRT1321412	hsa-miR-3619-3p	CLIP-seq
MIRT1321413	hsa-miR-4503	CLIP-seq
MIRT1321414	hsa-miR-4659a-3p	CLIP-seq
MIRT1321415	hsa-miR-4659b-3p	CLIP-seq
MIRT1321416	hsa-miR-4668-3p	CLIP-seq
MIRT1321417	hsa-miR-4776-5p	CLIP-seq
MIRT1321418	hsa-miR-4800-5p	CLIP-seq
MIRT1321419	hsa-miR-576-5p	CLIP-seq
MIRT2095428	hsa-miR-188-5p	CLIP-seq
MIRT2095429	hsa-miR-409-3p	CLIP-seq
MIRT2095430	hsa-miR-4269	CLIP-seq
MIRT2095431	hsa-miR-4438	CLIP-seq
MIRT2095432	hsa-miR-5095	CLIP-seq
MIRT2319814	hsa-miR-1252	CLIP-seq
MIRT2319815	hsa-miR-1265	CLIP-seq
MIRT2319816	hsa-miR-141	CLIP-seq
MIRT2319817	hsa-miR-200a	CLIP-seq
MIRT2319818	hsa-miR-3121-5p	CLIP-seq
MIRT2615614	hsa-miR-103a	CLIP-seq
MIRT2615615	hsa-miR-107	CLIP-seq
MIRT2615616	hsa-miR-125a-3p	CLIP-seq
MIRT2615617	hsa-miR-1270	CLIP-seq
MIRT2615618	hsa-miR-128	CLIP-seq
MIRT2615619	hsa-miR-1283	CLIP-seq
MIRT2615620	hsa-miR-1285	CLIP-seq
MIRT2615621	hsa-miR-1343	CLIP-seq
MIRT2615622	hsa-miR-15a	CLIP-seq
MIRT2615623	hsa-miR-15b	CLIP-seq
MIRT2615624	hsa-miR-16	CLIP-seq
MIRT2615625	hsa-miR-194	CLIP-seq
MIRT2615626	hsa-miR-195	CLIP-seq
MIRT2615627	hsa-miR-205	CLIP-seq
MIRT2615628	hsa-miR-216a	CLIP-seq
MIRT2615629	hsa-miR-216b	CLIP-seq
MIRT2615630	hsa-miR-2278	CLIP-seq
MIRT2615631	hsa-miR-27a	CLIP-seq
MIRT2615632	hsa-miR-27b	CLIP-seq
MIRT2615633	hsa-miR-3187-5p	CLIP-seq
MIRT2615634	hsa-miR-338-5p	CLIP-seq
MIRT2615635	hsa-miR-3618	CLIP-seq
MIRT2615636	hsa-miR-3663-3p	CLIP-seq
MIRT2615637	hsa-miR-376c	CLIP-seq
MIRT2615638	hsa-miR-3925-3p	CLIP-seq
MIRT2615639	hsa-miR-3929	CLIP-seq
MIRT2615640	hsa-miR-3936	CLIP-seq
MIRT2615641	hsa-miR-3945	CLIP-seq
MIRT2615642	hsa-miR-410	CLIP-seq
MIRT2615643	hsa-miR-424	CLIP-seq
MIRT2615644	hsa-miR-4253	CLIP-seq
MIRT2615645	hsa-miR-4267	CLIP-seq
MIRT2095430	hsa-miR-4269	CLIP-seq
MIRT2615646	hsa-miR-4328	CLIP-seq
MIRT2615647	hsa-miR-4419b	CLIP-seq
MIRT2615648	hsa-miR-4422	CLIP-seq
MIRT2095431	hsa-miR-4438	CLIP-seq
MIRT2615649	hsa-miR-4473	CLIP-seq
MIRT2615650	hsa-miR-4474-5p	CLIP-seq
MIRT2615651	hsa-miR-4478	CLIP-seq
MIRT2615652	hsa-miR-4524	CLIP-seq
MIRT2615653	hsa-miR-4531	CLIP-seq
MIRT2615654	hsa-miR-4663	CLIP-seq
MIRT2615655	hsa-miR-4803	CLIP-seq
MIRT2615656	hsa-miR-485-5p	CLIP-seq
MIRT2615657	hsa-miR-490-5p	CLIP-seq
MIRT2615658	hsa-miR-497	CLIP-seq
MIRT2615659	hsa-miR-500a	CLIP-seq
MIRT2615660	hsa-miR-503	CLIP-seq
MIRT2095432	hsa-miR-5095	CLIP-seq
MIRT2615661	hsa-miR-512-3p	CLIP-seq
MIRT2615662	hsa-miR-513a-5p	CLIP-seq
MIRT2615663	hsa-miR-520f	CLIP-seq
MIRT2615664	hsa-miR-548n	CLIP-seq
MIRT2615665	hsa-miR-552	CLIP-seq
MIRT2615666	hsa-miR-563	CLIP-seq
MIRT2615667	hsa-miR-612	CLIP-seq
MIRT2615668	hsa-miR-620	CLIP-seq
MIRT2615669	hsa-miR-627	CLIP-seq
MIRT2615670	hsa-miR-646	CLIP-seq
MIRT2615671	hsa-miR-766	CLIP-seq
MIRT2615672	hsa-miR-769-5p	CLIP-seq
MIRT2615673	hsa-miR-924	CLIP-seq
MIRT2615614	hsa-miR-103a	CLIP-seq
MIRT2615615	hsa-miR-107	CLIP-seq
MIRT2615616	hsa-miR-125a-3p	CLIP-seq
MIRT2615617	hsa-miR-1270	CLIP-seq
MIRT2615618	hsa-miR-128	CLIP-seq
MIRT2615619	hsa-miR-1283	CLIP-seq
MIRT2615620	hsa-miR-1285	CLIP-seq
MIRT2615621	hsa-miR-1343	CLIP-seq
MIRT2615622	hsa-miR-15a	CLIP-seq
MIRT2615623	hsa-miR-15b	CLIP-seq
MIRT2615624	hsa-miR-16	CLIP-seq
MIRT2615625	hsa-miR-194	CLIP-seq
MIRT2615626	hsa-miR-195	CLIP-seq
MIRT2615627	hsa-miR-205	CLIP-seq
MIRT2615628	hsa-miR-216a	CLIP-seq
MIRT2615629	hsa-miR-216b	CLIP-seq
MIRT2615630	hsa-miR-2278	CLIP-seq
MIRT2615631	hsa-miR-27a	CLIP-seq
MIRT2615632	hsa-miR-27b	CLIP-seq
MIRT2615633	hsa-miR-3187-5p	CLIP-seq
MIRT2615634	hsa-miR-338-5p	CLIP-seq
MIRT2615635	hsa-miR-3618	CLIP-seq
MIRT2615636	hsa-miR-3663-3p	CLIP-seq
MIRT2615637	hsa-miR-376c	CLIP-seq
MIRT2615638	hsa-miR-3925-3p	CLIP-seq
MIRT2615639	hsa-miR-3929	CLIP-seq
MIRT2615640	hsa-miR-3936	CLIP-seq
MIRT2615641	hsa-miR-3945	CLIP-seq
MIRT2615642	hsa-miR-410	CLIP-seq
MIRT2615643	hsa-miR-424	CLIP-seq
MIRT2615644	hsa-miR-4253	CLIP-seq
MIRT2615645	hsa-miR-4267	CLIP-seq
MIRT2095430	hsa-miR-4269	CLIP-seq
MIRT2615646	hsa-miR-4328	CLIP-seq
MIRT2615647	hsa-miR-4419b	CLIP-seq
MIRT2615648	hsa-miR-4422	CLIP-seq
MIRT2095431	hsa-miR-4438	CLIP-seq
MIRT2615649	hsa-miR-4473	CLIP-seq
MIRT2615650	hsa-miR-4474-5p	CLIP-seq
MIRT2615651	hsa-miR-4478	CLIP-seq
MIRT2615652	hsa-miR-4524	CLIP-seq
MIRT2615653	hsa-miR-4531	CLIP-seq
MIRT2615654	hsa-miR-4663	CLIP-seq
MIRT2615655	hsa-miR-4803	CLIP-seq
MIRT2615656	hsa-miR-485-5p	CLIP-seq
MIRT2615657	hsa-miR-490-5p	CLIP-seq
MIRT2615658	hsa-miR-497	CLIP-seq
MIRT2615659	hsa-miR-500a	CLIP-seq
MIRT2615660	hsa-miR-503	CLIP-seq
MIRT2095432	hsa-miR-5095	CLIP-seq
MIRT2615661	hsa-miR-512-3p	CLIP-seq
MIRT2615662	hsa-miR-513a-5p	CLIP-seq
MIRT2615663	hsa-miR-520f	CLIP-seq
MIRT2615664	hsa-miR-548n	CLIP-seq
MIRT2615665	hsa-miR-552	CLIP-seq
MIRT2615666	hsa-miR-563	CLIP-seq
MIRT2615667	hsa-miR-612	CLIP-seq
MIRT2615668	hsa-miR-620	CLIP-seq
MIRT2615669	hsa-miR-627	CLIP-seq
MIRT2615670	hsa-miR-646	CLIP-seq
MIRT2615671	hsa-miR-766	CLIP-seq
MIRT2615672	hsa-miR-769-5p	CLIP-seq
MIRT2615673	hsa-miR-924	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0001974	Process	Blood vessel remodeling	ISS
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	22615920
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	24431302
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IDA	29769720
GO:0030177	Process	Positive regulation of Wnt signaling pathway	NAS	24431302
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	ISS
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	TAS	24431302

MIM	HGNC	e!Ensembl
610574	20866	ENSG00000146374

Q9BXY4

Protein name

R-spondin-3 (Protein with TSP type-1 repeat) (hPWTSR) (Roof plate-specific spondin-3) (hRspo3) (Thrombospondin type-1 domain-containing protein 2)

Protein function

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled recep

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15913	Furin-like_2	41 → 142	Furin-like repeat, cysteine-rich	Domain
PF19028	TSP1_spondin	148 → 206	Spondin-like TSP1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node (PubMed:12463421). Highly expressed in endothelial cells (PubMed:26766444). {ECO:0000269|PubMed:12463421, ECO:0000269|PubMed:26

Sequence

MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES
SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Sequence length

272

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway		Regulation of FZD by ubiquitination RUNX1 regulates transcription of genes involved in WNT signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (28)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25531322, 31579414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	26733130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30329043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17468756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29748375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33320737	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	36129915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24847761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30329043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25531322, 31579414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37932819	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28779025, 29055915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	31851527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	35218958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27046199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25531322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22895193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22895193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33320737	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24847761, 25531322, 27511199, 28100566, 29127379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22895193, 28100566, 35254413, 36129915, 37998393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29127379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33320737	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	23128233, 26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27046199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30337838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30337838		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37731513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27046199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31739742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	27511199, 29127379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17468756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29748375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24847761, 25531322, 30987640, 31579414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30987640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30329043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26257057, 29748375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25531322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17468756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17468756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17468756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25531322, 26735887, 27511199, 28695896, 29127379, 29748375, 31851527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26132169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24430505		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29055915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30987640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37731513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26416247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	35218958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	26733130		★★★★★ ★☆☆☆☆ Found in Text Mining only

RSPO3 (R-spondin 3)