HAVCR2 (hepatitis A virus cellular receptor 2)

Gene

• Entrez ID: 84868
• Gene name: Hepatitis A virus cellular receptor 2
• Gene symbol: HAVCR2
• Synonyms (NCBI Gene): CD366, HAVcr-2, KIM-3, SPTCL, TIM3, TIMD-3, TIMD3, Tim-3
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involv

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs35960726	T>C	Risk-factor	Coding sequence variant, missense variant
rs147827860	G>A	Risk-factor	Coding sequence variant, missense variant
rs184868814	T>C	Risk-factor	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT459333	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459332	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459331	hsa-miR-940	PAR-CLIP	23592263
MIRT459330	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT459329	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT459328	hsa-miR-1825	PAR-CLIP	23592263
MIRT459327	hsa-miR-1827	PAR-CLIP	23592263
MIRT459326	hsa-miR-6089	PAR-CLIP	23592263
MIRT459325	hsa-miR-1251-3p	PAR-CLIP	23592263
MIRT459324	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT459323	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT459322	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT459321	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT459320	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT459319	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT459318	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT459317	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT459316	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT459315	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT459314	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT459313	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT459312	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT459311	hsa-miR-3689c	PAR-CLIP	23592263
MIRT459310	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT459309	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT459308	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT459307	hsa-miR-3122	PAR-CLIP	23592263
MIRT459306	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT459305	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT459304	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT733387	hsa-miR-133a-5p	qRT-PCR, Flow cytometry	32647415
MIRT459333	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT459332	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT459331	hsa-miR-940	PAR-CLIP	23592263
MIRT459330	hsa-miR-302c-3p	PAR-CLIP	23592263
MIRT459329	hsa-miR-520f-3p	PAR-CLIP	23592263
MIRT459328	hsa-miR-1825	PAR-CLIP	23592263
MIRT459327	hsa-miR-1827	PAR-CLIP	23592263
MIRT459326	hsa-miR-6089	PAR-CLIP	23592263
MIRT459325	hsa-miR-1251-3p	PAR-CLIP	23592263
MIRT459324	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT459323	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT459322	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT459321	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT459320	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT459319	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT459318	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT459317	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT459316	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT459315	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT459314	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT459313	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT459312	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT459311	hsa-miR-3689c	PAR-CLIP	23592263
MIRT459310	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT459309	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT459308	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT459307	hsa-miR-3122	PAR-CLIP	23592263
MIRT459306	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT459305	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT459304	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT1041409	hsa-miR-193a-3p	CLIP-seq
MIRT1041410	hsa-miR-193b	CLIP-seq
MIRT1041411	hsa-miR-24	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT1041417	hsa-miR-3672	CLIP-seq
MIRT1041418	hsa-miR-3926	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041420	hsa-miR-4284	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT1041426	hsa-miR-4537	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041431	hsa-miR-4786-5p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT1041435	hsa-miR-548s	CLIP-seq
MIRT1041436	hsa-miR-769-5p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT2008672	hsa-miR-1205	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT2008674	hsa-miR-1909	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008675	hsa-miR-3173-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT2008681	hsa-miR-4436b-3p	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2008683	hsa-miR-4690-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT2241112	hsa-miR-4327	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041426	hsa-miR-4537	CLIP-seq
MIRT2241113	hsa-miR-4639-3p	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2241114	hsa-miR-4661-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544659	hsa-miR-10a	CLIP-seq
MIRT2544660	hsa-miR-10b	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2544661	hsa-miR-3065-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2544662	hsa-miR-323-5p	CLIP-seq
MIRT2544663	hsa-miR-339-5p	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT2544664	hsa-miR-3622b-5p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT2544665	hsa-miR-3945	CLIP-seq
MIRT2544666	hsa-miR-4253	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2544667	hsa-miR-4421	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2544668	hsa-miR-4684-5p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2008685	hsa-miR-4722-5p	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544669	hsa-miR-548c-3p	CLIP-seq
MIRT2544670	hsa-miR-593	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008689	hsa-miR-665	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT2544671	hsa-miR-876-3p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq
MIRT2544659	hsa-miR-10a	CLIP-seq
MIRT2544660	hsa-miR-10b	CLIP-seq
MIRT1041408	hsa-miR-1227	CLIP-seq
MIRT2008673	hsa-miR-1285	CLIP-seq
MIRT1041412	hsa-miR-25	CLIP-seq
MIRT2544661	hsa-miR-3065-5p	CLIP-seq
MIRT2008676	hsa-miR-3187-5p	CLIP-seq
MIRT1041413	hsa-miR-32	CLIP-seq
MIRT2544662	hsa-miR-323-5p	CLIP-seq
MIRT2544663	hsa-miR-339-5p	CLIP-seq
MIRT2008677	hsa-miR-3613-3p	CLIP-seq
MIRT2544664	hsa-miR-3622b-5p	CLIP-seq
MIRT1041414	hsa-miR-363	CLIP-seq
MIRT1041415	hsa-miR-3664-3p	CLIP-seq
MIRT1041416	hsa-miR-367	CLIP-seq
MIRT2008678	hsa-miR-371-5p	CLIP-seq
MIRT2008679	hsa-miR-371b-5p	CLIP-seq
MIRT1041419	hsa-miR-3929	CLIP-seq
MIRT2544665	hsa-miR-3945	CLIP-seq
MIRT2544666	hsa-miR-4253	CLIP-seq
MIRT1041421	hsa-miR-4325	CLIP-seq
MIRT1041422	hsa-miR-4419b	CLIP-seq
MIRT2544667	hsa-miR-4421	CLIP-seq
MIRT2008680	hsa-miR-4432	CLIP-seq
MIRT1041423	hsa-miR-4433	CLIP-seq
MIRT1041424	hsa-miR-4459	CLIP-seq
MIRT1041425	hsa-miR-4478	CLIP-seq
MIRT2008682	hsa-miR-451b	CLIP-seq
MIRT1041427	hsa-miR-4649-3p	CLIP-seq
MIRT2544668	hsa-miR-4684-5p	CLIP-seq
MIRT1041428	hsa-miR-4691-3p	CLIP-seq
MIRT1041429	hsa-miR-4695-5p	CLIP-seq
MIRT2008684	hsa-miR-4696	CLIP-seq
MIRT2241115	hsa-miR-4742-5p	CLIP-seq
MIRT1041430	hsa-miR-4768-3p	CLIP-seq
MIRT1041432	hsa-miR-485-5p	CLIP-seq
MIRT2008686	hsa-miR-508-5p	CLIP-seq
MIRT1041433	hsa-miR-510	CLIP-seq
MIRT1041434	hsa-miR-520f	CLIP-seq
MIRT2544669	hsa-miR-548c-3p	CLIP-seq
MIRT2544670	hsa-miR-593	CLIP-seq
MIRT2008687	hsa-miR-612	CLIP-seq
MIRT2008688	hsa-miR-661	CLIP-seq
MIRT2008690	hsa-miR-766	CLIP-seq
MIRT2544671	hsa-miR-876-3p	CLIP-seq
MIRT1041437	hsa-miR-92a	CLIP-seq
MIRT1041438	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002519	Process	Natural killer cell tolerance induction	IMP	25578313
GO:0002652	Process	Regulation of tolerance induction dependent upon immune response	IEA
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IDA	16286920
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0002838	Process	Negative regulation of immune response to tumor cell	IEA
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	16286920
GO:0005515	Function	Protein binding	IDA	34110282
GO:0005515	Function	Protein binding	IPI	25363763, 32296183
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	30374066
GO:0005886	Component	Plasma membrane	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0009986	Component	Cell surface	IDA	25363763
GO:0009986	Component	Cell surface	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	25578313
GO:0016020	Component	Membrane	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IMP	22842346
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	22842346
GO:0032480	Process	Negative regulation of type I interferon production	IEA
GO:0032687	Process	Negative regulation of interferon-alpha production	IDA	26492563
GO:0032689	Process	Negative regulation of type II interferon production	IDA	26492563
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	26492563
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032712	Process	Negative regulation of interleukin-3 production	IDA	26492563
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	25578313
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IMP	25578313
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	18006747
GO:0032815	Process	Negative regulation of natural killer cell activation	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IEA
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IDA	25578313
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071656	Process	Negative regulation of granulocyte colony-stimulating factor production	IDA	26492563
GO:1900425	Process	Negative regulation of defense response to bacterium	IEA
GO:1900426	Process	Positive regulation of defense response to bacterium	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:2000521	Process	Negative regulation of immunological synapse formation	IEA
GO:2001189	Process	Negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	26492563

Other IDs

• MIM: 606652
• HGNC: 18437
• e!Ensembl: ENSG00000135077

Protein

• UniProt ID: Q8TDQ0
• Protein name: Hepatitis A virus cellular receptor 2 (HAVcr-2) (T-cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T-cell immunoglobulin mucin receptor 3) (TIM-3) (T-cell membrane protein 3) (CD antigen CD366)
• Protein function: Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or t
• PDB: 5DZL, 5F71, 6DHB, 6TXZ, 7KQL, 7M3Y, 7M3Z, 7M41, 8HGJ, 8TBB, 8TFT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	21 → 130	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in T-helper type 1 (Th1) lymphocytes. Expressed on regulatory T (Treg) cells after TCR stimulation. Expressed in dendritic cells and natural killer (NK) cells. Expressed in epithelial tissues. Expression is increased on CD4+
• Sequence:

  MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
  FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
  EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
  NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
  SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
  P

• Sequence length: 301

Pathways

KEGG:

Efferocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HAVCR2-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOHISTIOCYTOSIS, HEMOPHAGOCYTIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcutaneous panniculitis-like T-cell lymphoma	Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30635636, 31376919		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29254227, 29632738, 31291985		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30459127		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24046178		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26428847, 29844001, 29858021, 31516613		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30635636		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31007846		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30384489		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15603868		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30243069		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37479109	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24905803, 28179599, 29625390		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	38016492	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	LHGDN	18485114		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23334427		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28977841, 29288118		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	36190378	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39662827	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30106887	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12618867, 15603868, 15867855, 16938542, 19494522, 21470319, 28865412, 30644695		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28865412, 35029177	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30644695	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	33244787	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	31227543, 38183111	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28977841, 29288118		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32467985	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33015716	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	Pubtator	39354406	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30590210		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	22371007, 28257599		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11823861, 15272240, 15325803, 15603868, 16754722, 16938542, 18354161, 19768575, 20133006, 21697013, 22438246, 22725958, 24412470, 26076826, 26125859, 27091308, 27792886, 28754800, 28974109, 29315553, 30377229, 31044630		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16754722, 17665973		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	16754722, 22438246, 23388728, 23526963, 26076826, 28974109, 31644615, 32319832, 39456777	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	20176801		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31644615		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28681697		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	32878426	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28074937	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30243902		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24833097	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34670827, 37586773	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26141233, 27248321, 29163490, 29316433, 30377566, 30607162, 30759303, 31354733		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27248321, 29983831, 30759303, 31292534, 32616706, 36271406, 36388159, 38069525	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36763585	Stimulate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	27008699		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31661141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31612039		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37926435	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	38101862	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22505239, 23526963, 24867713, 27034168, 28033288, 29666149, 29706626, 31927532, 32170378, 34249476, 34777920, 34808386, 35592706, 36042180, 37077908, 39330965, 39838375	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30243902		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31801611		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37868997	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37347110	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22505239, 26715281, 28112366, 29553498, 30630458, 32277125, 32396851, 33389015, 34545095, 34867961, 36768365	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28423034, 32139873, 35799269, 36759392	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28357631, 29616115		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34101055	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	23665438	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23335978, 31661141		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23335978		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23335978, 31661141		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30635636		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19494522		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35597869	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31197461		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	31197461	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27511728, 30870839		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29759032		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	29759032		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23291409, 28033288, 30304545		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23117395		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26339368, 27881010, 31726050		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32468013	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26008981, 26339368, 27881010, 28035413, 28038383, 28440449, 29905955, 29963183, 30081950		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26008981, 26339368, 29770915, 31726050, 31921188, 32265897, 32509862, 33229508, 33338327, 34996408, 36968142, 37178411, 39739032	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28035413, 30081950, 32393998	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	20133006, 21392402, 23112829, 24397461, 26215444, 29089040, 30729555		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1C	Congenital disorder of glycosylation	Pubtator	34625514	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22472081, 24195506, 26253654, 27872087, 28112366, 30630458		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21463244		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25071071	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	24477913	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21263071	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25876049, 25937557, 27044824, 28393295		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	24486565		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	35967337	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16940744		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	38153165	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29433065		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27182056, 33123595, 35966054, 37082729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29433065		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38030055	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35966054	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27182056	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33123595, 35464400, 37082729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18401547		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30862474		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30384489, 31007846		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	29974826		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16159638, 16940744		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29107214		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30926882		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30926882, 35804040, 36199963	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29511377, 32231038, 36983021	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21470319		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29616115		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27577071, 31109341		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27577071, 31109341		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27577071, 33323552	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30128737, 31882943, 34625514	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	27990849	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	36159840	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20133006, 29735977		★☆☆☆☆ Found in Text Mining only
Fetal Resorption	Fetal Resorption	BEFREE	28331165		★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23555014, 29735977		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37828574	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35094125	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29526824, 33681387	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	25520133	Associate	★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	36875956	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27358487, 28919992, 31632537		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28880903, 33800561, 35558067, 35628503, 35857445, 37884280, 38057698, 39513882	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27358487, 28736431, 28880903, 28919992, 31632537		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24512143, 27358487, 28919992, 29174343, 31436247		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31436247, 33800561, 34923867, 35216164, 35857445, 39840558, 40696074	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35198632	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	37075987	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	33244787	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28478120	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28478120		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22968087, 29974826		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29974826	Inhibit	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	29974826	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28102051, 28197389, 28408386, 29506555, 31612039		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28408386, 35140722	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30233564		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	38640253	Associate	★☆☆☆☆ Found in Text Mining only
Hemophagocytic Lymphohistiocytosis, Familial, 1	Hemophagocytic Lymphohistiocytosis	CTD_human_DG	30374066		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	CTD_human_DG	30374066		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	28974109	Inhibit	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28257599	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24867713, 27034168, 28033288, 30939292, 34249476, 39456777	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29666149, 30939292	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23388728, 34930041	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32994477	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30384489		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	34584203, 34941990	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	34930041	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31162951		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23291409		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	32231038	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19332093, 24231118, 24412470, 28974109, 31090595		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25348621, 29987244, 31776569		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	21463244		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30759303	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30243071, 30366277		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30607162		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31576093		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29985717		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27549193	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23554257, 27424989, 30292745, 36545697, 36622326, 36960055, 37919606, 38022614	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27424989, 30209120		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22323453, 23554257, 24855276, 25400771, 25886742, 27506934, 29720577, 29843224, 29908544, 29946192, 31291985, 33094319, 33463129, 33758676, 34129052, 34543390, 34913594, 35297213, 35558161, 35642341, 36545697, 37730831, 38022614, 38267906, 39582863, 40225861	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38536023	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23554257, 24046178, 24855276, 25400771, 27565576, 28750861, 29254227, 29632738, 29872582, 29908544, 29946192, 30107988, 30500073, 30708194, 31014360, 31291985, 31354733		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22505239, 22587604, 23291409, 24867713, 25608525, 27034168, 28033288, 29113224, 29434984, 29706626, 29760564, 30145359, 30309387, 30710754, 31612039, 31848194		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23291409, 28033288, 30304545		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	32994477	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	37915081	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	34867961	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25520133, 34670827, 35836920, 36865498	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34510768	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18052965, 33641540, 37802602	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26076826, 34101055	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18052965, 19768575, 21367814, 26076826, 28754800		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18052965		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24339967, 26339368, 26464703, 27248321, 28035413, 32506804	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26339368		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36865498	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	34535012, 36503528, 37479109, 38077348	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	30374066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	CTD_human_DG	30374066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	20176801		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20176801, 31672704, 33015716	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	37899130	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	24569779		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24569779		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24569779		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31787505		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28919992, 31609000		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28102051, 28197389, 28408386, 29506555, 31612039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26141233, 27248321, 29163490, 29316433, 30377566, 30607162, 30759303, 30924846, 31354733		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27577071, 31109341		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30187676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27549193		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29449693		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31801611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28357631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22733499, 28241889, 29551917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23886204, 28681697, 28827755, 28952222, 30509105		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31354733		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20811886, 24919464, 26214042, 30106451, 30675200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30243902		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22323453, 23359271, 24195506, 24343228, 26253654, 27008699, 27358487, 27430162, 27911104, 28152393, 28258697, 28300768, 28423646, 28585539, 28606939, 28671022, 28800954, 29113224, 29706626, 30410357, 30926882, 31241380, 31676858, 31709176, 31733828, 31756785		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28475007		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23335978, 31661141		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26339368, 31726050		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30554083, 31354733		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17096021		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17096021, 22205715, 24343228, 24795354, 31747929, 33015716, 36433984, 39716918	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20819923	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27846884, 28132803, 28344869, 30728151, 31747929		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28197385		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	24343228		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28827755		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25578313, 29083087, 31138782, 31329823		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30196822		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29943497		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33257767, 39308517	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36605214	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15153541, 16754722, 18354161, 19768575, 23406933, 27091308, 27544230, 29141799, 30196822		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16754722, 18354161		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16754722, 20176801, 31134049	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	31134049	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29179486, 31511310, 31756785		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24855276, 27565576, 31756785, 34543390, 36282797	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	31034608		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	29759032		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	39347549	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	28901003		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28871094		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28871094	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36913701	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20574007, 20811886, 21697013, 22505239, 23240746, 23335978, 23554257, 23886204, 24195506, 24343228, 24512143, 25400771, 25608525, 26008981, 26141233, 26214042, 26253654, 26339368, 26428847, 27430162, 27577071, 27872087, 27911104, 28033288, 28035413, 28038383, 28102051, 28197389, 28258697, 28274143, 28277277, 28300768, 28357631, 28423034, 28423646, 28430664, 28440449, 28585539, 28606939, 28681697, 28880903, 28919992, 28920005, 29047105, 29174343, 29316433, 29434984, 29449693, 29551917, 29553498, 29615398, 29943497, 29963183, 29983831, 30042205, 30101129, 30106451, 30266483, 30377566, 30482746, 30509105, 30554083, 30607162, 30619178, 30622534, 30675200, 30713791, 30728151, 30759303, 30876792, 30926882, 31053602, 31069154, 31105699, 31109341, 31138782, 31612039, 31651542, 31672704, 31695700, 31733828, 31787505, 31801611, 31848194		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37130627	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28475007	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28871094		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23359271, 28236980, 29440769, 29452091, 31053602, 31612039		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29735977		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33123595	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	37175405	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27044824	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27706678, 28103502, 28671022, 31612039		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27706678, 33959121, 36519392, 37858131	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28671022	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	32334621	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28357631		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23526963	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26482613, 33887301, 35186171, 35326415, 37876933	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22733499, 28241889, 29551917		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28241889, 38132831	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	30459127	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28637584		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	BEFREE	11272897		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	Pubtator	36171125	Associate	★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	38193541	Associate	★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	33937096	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	26008981	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	33767694	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34502071	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	40761788	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29368793, 31672704		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31376919		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23886204, 28681697, 28827755, 28952222		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26993768	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23886204, 25119597, 26289091, 28681697, 28827755, 28952222, 33569050, 33934205, 36124532	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	22294262	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31162951		★☆☆☆☆ Found in Text Mining only
Reactive Hemophagocytic Syndrome	Reactive Hemophagocytic Syndrome	CTD_human_DG	30374066		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27549193		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22472081, 26253654, 27872087, 28112366, 29553498, 30630458		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	34535012	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15325803, 19768575, 21565238, 21717191, 21989170, 22353209, 23385979, 23406933, 24689929, 28791012, 28962218, 29626269, 30106887, 30730912		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15325803		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	28901003		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19480659		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19480659	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	31263176, 32792357	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35502507	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27504802, 29135922, 29689313		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	28637584		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency Autosomal Recessive T Cell Negative B Cell Positive NK Cell Positive	Severe combined immunodeficiency	Pubtator	35464400	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	25348621		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34228218	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28466780		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27430162, 29344243		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28466780, 31089395, 33396515, 33995377, 34729919, 35794182	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28102051, 28197389, 28408386, 29506555, 29712685, 30042205, 30728151		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29735977		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20811886, 24919464, 26214042, 30106451, 30675200		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20811886, 24339967, 26464703, 32858135, 33575321, 33611641, 34367732, 34725458, 35664061, 36002752, 37798754	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36680216	Stimulate	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	28405495, 30374066, 30792187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	CTD_human_DG	30374066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	ORPHANET_DG	30374066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	29245183		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30374066, 30429576, 31672704		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	27990849		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29974826		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	37464189	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25701326, 35574031, 37501393	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	25880730	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	37501789	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30607162		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33823818, 37924153	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	30926882	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23117395, 30594639		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31174611, 40367012	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	32139873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23335978, 31661141, 33306195, 35435763	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	25784621, 31046170		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	25784621, 31046170		★☆☆☆☆ Found in Text Mining only