PTPN5 (protein tyrosine phosphatase non-receptor type 5)

Gene

• Entrez ID: 84867
• Gene name: Protein tyrosine phosphatase non-receptor type 5
• Gene symbol: PTPN5
• Synonyms (NCBI Gene): PTPSTEP, STEP, STEP61
• Chromosome: 11
• Chromosome location: 11p15.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1275706	hsa-miR-128	CLIP-seq
MIRT1275707	hsa-miR-1343	CLIP-seq
MIRT1275708	hsa-miR-3064-5p	CLIP-seq
MIRT1275709	hsa-miR-3150b-3p	CLIP-seq
MIRT1275710	hsa-miR-3667-3p	CLIP-seq
MIRT1275711	hsa-miR-3670	CLIP-seq
MIRT1275712	hsa-miR-4689	CLIP-seq
MIRT1275713	hsa-miR-4784	CLIP-seq
MIRT1275714	hsa-miR-101	CLIP-seq
MIRT1275715	hsa-miR-1285	CLIP-seq
MIRT1275716	hsa-miR-1287	CLIP-seq
MIRT1275717	hsa-miR-144	CLIP-seq
MIRT1275718	hsa-miR-1587	CLIP-seq
MIRT1275719	hsa-miR-3120-5p	CLIP-seq
MIRT1275720	hsa-miR-3135b	CLIP-seq
MIRT1275721	hsa-miR-3187-5p	CLIP-seq
MIRT1275722	hsa-miR-378g	CLIP-seq
MIRT1275723	hsa-miR-3908	CLIP-seq
MIRT1275724	hsa-miR-4286	CLIP-seq
MIRT1275725	hsa-miR-4476	CLIP-seq
MIRT1275726	hsa-miR-4486	CLIP-seq
MIRT1275727	hsa-miR-4492	CLIP-seq
MIRT1275728	hsa-miR-4498	CLIP-seq
MIRT1275729	hsa-miR-4656	CLIP-seq
MIRT1275730	hsa-miR-4675	CLIP-seq
MIRT1275731	hsa-miR-4741	CLIP-seq
MIRT1275732	hsa-miR-593	CLIP-seq
MIRT1275733	hsa-miR-612	CLIP-seq
MIRT1275734	hsa-miR-762	CLIP-seq
MIRT2081137	hsa-miR-1273f	CLIP-seq
MIRT2081138	hsa-miR-3134	CLIP-seq
MIRT2081139	hsa-miR-4756-3p	CLIP-seq
MIRT2307066	hsa-miR-1260	CLIP-seq
MIRT2307067	hsa-miR-1260b	CLIP-seq
MIRT1275706	hsa-miR-128	CLIP-seq
MIRT1275715	hsa-miR-1285	CLIP-seq
MIRT2307068	hsa-miR-188-3p	CLIP-seq
MIRT2307069	hsa-miR-3156-3p	CLIP-seq
MIRT1275721	hsa-miR-3187-5p	CLIP-seq
MIRT1275733	hsa-miR-612	CLIP-seq
MIRT2307070	hsa-miR-642b	CLIP-seq
MIRT2457458	hsa-miR-3942-5p	CLIP-seq
MIRT2457459	hsa-miR-4703-5p	CLIP-seq
MIRT2457460	hsa-miR-545	CLIP-seq
MIRT2604586	hsa-miR-1200	CLIP-seq
MIRT2604587	hsa-miR-3660	CLIP-seq
MIRT2604588	hsa-miR-4324	CLIP-seq
MIRT2604589	hsa-miR-4526	CLIP-seq
MIRT2604590	hsa-miR-4667-3p	CLIP-seq
MIRT2604591	hsa-miR-544b	CLIP-seq
MIRT1275711	hsa-miR-3670	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IDA	16441242
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS	7490079
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 31515488, 32296183
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006470	Process	Protein dephosphorylation	TAS	7490079
GO:0007165	Process	Signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030054	Component	Cell junction	IBA

Other IDs

• MIM: 176879
• HGNC: 9657
• e!Ensembl: ENSG00000110786

Protein

• UniProt ID: P54829
• Protein name: Tyrosine-protein phosphatase non-receptor type 5 (EC 3.1.3.48) (Neural-specific protein-tyrosine phosphatase) (Striatum-enriched protein-tyrosine phosphatase) (STEP)
• Protein function: May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.
• PDB: 2BIJ, 2BV5, 2CJZ, 5OVR, 5OVX, 5OW1, 6H8R, 8SLS, 8SLT, 8SLU, 9EEX, 9EEY, 9EEZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00102	Y_phosphatase	323 → 553	Protein-tyrosine phosphatase	Domain

• Sequence:

  MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPP
  PPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLV
  SSLLTLLKQLEPTAWLDSGTWGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPED
  RRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQ
  ERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL
  QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIR
  GYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD
  GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEE
  AAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQ
  TCEQYQFVHHVMSLYEKQLSHQSPE

• Sequence length: 565

Pathways

KEGG:

MAPK signaling pathway

Reactome:

Interleukin-37 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amnesia	Amnesia	BEFREE	22090472		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20872766, 25956630		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29590203		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30176350		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19000305	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30367948		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30706604		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	28943283		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21779398, 24588402, 30176350		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29394353		★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	26872063		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31365829		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30176350		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37399741	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29590203		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28961835, 29110686, 29495960, 30243056, 31098999		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30367948		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30760987		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	27548030		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	28628590		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	GWASCAT_DG	27182965		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29590203		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31520531		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31691882		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37399741	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31138256		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25583483		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22555153, 22781170, 25956630, 28466270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22555153, 22781170		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25956630	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations