TMEM25 (transmembrane protein 25)

Gene

• Entrez ID: 84866
• Gene name: Transmembrane protein 25
• Gene symbol: TMEM25
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017126	hsa-miR-335-5p	Microarray	18185580
MIRT019718	hsa-miR-375	Microarray	20215506
MIRT039576	hsa-miR-636	CLASH	23622248
MIRT036448	hsa-miR-1226-3p	CLASH	23622248
MIRT1436177	hsa-miR-3614-3p	CLIP-seq
MIRT1436178	hsa-miR-582-3p	CLIP-seq
MIRT1436179	hsa-miR-1224-3p	CLIP-seq
MIRT1436180	hsa-miR-1913	CLIP-seq
MIRT1436181	hsa-miR-324-3p	CLIP-seq
MIRT1436182	hsa-miR-4714-3p	CLIP-seq
MIRT1436183	hsa-miR-642a	CLIP-seq
MIRT1436184	hsa-miR-1827	CLIP-seq
MIRT1436185	hsa-miR-3074-5p	CLIP-seq
MIRT1436186	hsa-miR-3667-3p	CLIP-seq
MIRT1436187	hsa-miR-370	CLIP-seq
MIRT1436188	hsa-miR-4502	CLIP-seq
MIRT2352035	hsa-miR-1183	CLIP-seq
MIRT2352036	hsa-miR-1236	CLIP-seq
MIRT1436184	hsa-miR-1827	CLIP-seq
MIRT2352037	hsa-miR-18a	CLIP-seq
MIRT2352038	hsa-miR-18b	CLIP-seq
MIRT2352039	hsa-miR-1972	CLIP-seq
MIRT2352040	hsa-miR-221	CLIP-seq
MIRT2352041	hsa-miR-222	CLIP-seq
MIRT2352042	hsa-miR-3064-3p	CLIP-seq
MIRT1436185	hsa-miR-3074-5p	CLIP-seq
MIRT2352043	hsa-miR-3126-5p	CLIP-seq
MIRT2352044	hsa-miR-3202	CLIP-seq
MIRT2352045	hsa-miR-34a	CLIP-seq
MIRT2352046	hsa-miR-34c-5p	CLIP-seq
MIRT2352047	hsa-miR-3614-5p	CLIP-seq
MIRT1436186	hsa-miR-3667-3p	CLIP-seq
MIRT1436187	hsa-miR-370	CLIP-seq
MIRT2352048	hsa-miR-376c	CLIP-seq
MIRT2352049	hsa-miR-4419a	CLIP-seq
MIRT2352050	hsa-miR-449a	CLIP-seq
MIRT2352051	hsa-miR-449b	CLIP-seq
MIRT1436188	hsa-miR-4502	CLIP-seq
MIRT2352052	hsa-miR-4510	CLIP-seq
MIRT2352053	hsa-miR-4691-5p	CLIP-seq
MIRT2352054	hsa-miR-4735-3p	CLIP-seq
MIRT2352055	hsa-miR-4743	CLIP-seq
MIRT2352056	hsa-miR-4761-5p	CLIP-seq
MIRT2352057	hsa-miR-4763-5p	CLIP-seq
MIRT2352058	hsa-miR-4796-3p	CLIP-seq
MIRT2352059	hsa-miR-544b	CLIP-seq
MIRT2352060	hsa-miR-548p	CLIP-seq
MIRT2352061	hsa-miR-548t	CLIP-seq
MIRT2352062	hsa-miR-624	CLIP-seq
MIRT2352063	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 29892012
GO:0005576	Component	Extracellular region	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0090394	Process	Negative regulation of excitatory postsynaptic potential	IBA
GO:0090394	Process	Negative regulation of excitatory postsynaptic potential	IEA
GO:0090394	Process	Negative regulation of excitatory postsynaptic potential	ISS

Other IDs

• MIM: 613934
• HGNC: 25890
• e!Ensembl: ENSG00000149582

Protein

• UniProt ID: Q86YD3
• Protein name: Transmembrane protein 25
• Protein function: In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08205	C2-set_2	26 → 118	CD80-like C2-set immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed throughout the brain with higher levels in the pyramidal cell layer of the hippocampal CA1 and CA3 regions. Also highly expressed within the hippocampal dentate gyrus region and cerebellum and in scattered neurons in the cere
• Sequence:

  MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
  PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANA
  SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
  VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVV
  AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPS
  NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVS
  SDEIWL

• Sequence length: 366

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19776672	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38189809	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23324576		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23324576	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31424425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23324576		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19776672	Associate	★☆☆☆☆ Found in Text Mining only