Gene Gene information from NCBI Gene database.
Entrez ID 84839
Gene name Retina and anterior neural fold homeobox 2
Gene symbol RAX2
Synonyms (NCBI Gene)
ARMD6CORD11QRXRAXL1RP95
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epit
SNPs SNP information provided by dbSNP.
6
SNP ID Visualize variation Clinical significance Consequence
rs121908280 C>A,G,T Pathogenic Coding sequence variant, missense variant
rs121908281 C>G Pathogenic Coding sequence variant, missense variant
rs141804618 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs398124431 G>A,T Pathogenic Stop gained, coding sequence variant, missense variant
rs549932754 ->GGGCCC Pathogenic Inframe insertion, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
131
miRTarBase ID miRNA Experiments Reference
MIRT1293292 hsa-miR-122 CLIP-seq
MIRT1293293 hsa-miR-1267 CLIP-seq
MIRT1293294 hsa-miR-149 CLIP-seq
MIRT1293295 hsa-miR-1976 CLIP-seq
MIRT1293296 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15028672
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610362 18286 ENSG00000173976
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96IS3
Protein name Retina and anterior neural fold homeobox protein 2 (Q50-type retinal homeobox protein) (Retina and anterior neural fold homeobox-like protein 1)
Protein function May be involved in modulating the expression of photoreceptor specific genes. Binds to the Ret-1 and Bat-1 element within the rhodopsin promoter.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 28 84 Homeodomain Domain
Sequence
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREEL
AAKVHLPEVRVQVWFQNRRAKWRR
QERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEP
WLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRA
WPPA
Sequence length 184
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cone-rod dystrophy 11 Pathogenic; Likely pathogenic rs121908281, rs886041039, rs2512317329 RCV000001300
RCV000190344
RCV004555449
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinal dystrophy Likely pathogenic; Pathogenic rs886041039, rs76076446 RCV001074414
RCV001073633
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinitis pigmentosa 95 Pathogenic rs2037262817 RCV002294542
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Age related macular degeneration 6 Benign; Uncertain significance; Conflicting classifications of pathogenicity; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONE ROD DYSTROPHY Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONE-ROD DYSTROPHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONE-ROD DYSTROPHY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Age related macular degeneration Age-related macular degeneration HPO_DG
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration GENOMICS_ENGLAND_DG
★☆☆☆☆
Found in Text Mining only
Atrophoderma maculatum Anetoderma HPO_DG
★☆☆☆☆
Found in Text Mining only
Cone rod dystrophy Cone-rod dystrophy Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cone-Rod Dystrophies Cone-rod dystrophy HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cone-Rod Dystrophy 11 Cone-rod dystrophy UNIPROT_DG 15028672
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-Rod Dystrophy 11 Cone-rod dystrophy GENOMICS_ENGLAND_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-Rod Dystrophy 11 Cone-rod dystrophy CLINVAR_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-Rod Dystrophy 11 Cone-rod dystrophy CTD_human_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-Rod Dystrophy 2 Cone-rod dystrophy ORPHANET_DG 15028672, 25789692
★☆☆☆☆
Found in Text Mining only