Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84817
Gene name	Thioredoxin domain containing 17
Gene symbol	TXNDC17
Synonyms (NCBI Gene)	TRP14TXNL5
Chromosome	17
Chromosome location	17p13.1

Show/Hide all (88)

miRTarBase ID	miRNA	Experiments	Reference
MIRT719816	hsa-miR-4328	HITS-CLIP	19536157
MIRT719815	hsa-miR-4729	HITS-CLIP	19536157
MIRT719814	hsa-miR-3143	HITS-CLIP	19536157
MIRT719813	hsa-miR-137	HITS-CLIP	19536157
MIRT719812	hsa-miR-5696	HITS-CLIP	19536157
MIRT719811	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT719810	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT719816	hsa-miR-4328	HITS-CLIP	19536157
MIRT719815	hsa-miR-4729	HITS-CLIP	19536157
MIRT719814	hsa-miR-3143	HITS-CLIP	19536157
MIRT719813	hsa-miR-137	HITS-CLIP	19536157
MIRT719812	hsa-miR-5696	HITS-CLIP	19536157
MIRT719811	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT719810	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT1465074	hsa-miR-28-3p	CLIP-seq
MIRT1465075	hsa-miR-3121-5p	CLIP-seq
MIRT1465076	hsa-miR-3122	CLIP-seq
MIRT1465077	hsa-miR-3153	CLIP-seq
MIRT1465078	hsa-miR-330-3p	CLIP-seq
MIRT1465079	hsa-miR-3617	CLIP-seq
MIRT1465080	hsa-miR-3689a-3p	CLIP-seq
MIRT1465081	hsa-miR-3689c	CLIP-seq
MIRT1465082	hsa-miR-3913-3p	CLIP-seq
MIRT1465083	hsa-miR-3913-5p	CLIP-seq
MIRT1465084	hsa-miR-4436a	CLIP-seq
MIRT1465085	hsa-miR-4452	CLIP-seq
MIRT1465086	hsa-miR-4639-5p	CLIP-seq
MIRT1465087	hsa-miR-4668-5p	CLIP-seq
MIRT1465088	hsa-miR-4728-5p	CLIP-seq
MIRT1465089	hsa-miR-4773	CLIP-seq
MIRT1465090	hsa-miR-582-5p	CLIP-seq
MIRT1465091	hsa-miR-641	CLIP-seq
MIRT2139917	hsa-miR-1184	CLIP-seq
MIRT2139918	hsa-miR-1205	CLIP-seq
MIRT2139919	hsa-miR-1286	CLIP-seq
MIRT2139920	hsa-miR-1976	CLIP-seq
MIRT2139921	hsa-miR-31	CLIP-seq
MIRT2139922	hsa-miR-3158-5p	CLIP-seq
MIRT1465078	hsa-miR-330-3p	CLIP-seq
MIRT2139923	hsa-miR-3690	CLIP-seq
MIRT1465082	hsa-miR-3913-3p	CLIP-seq
MIRT2139924	hsa-miR-3936	CLIP-seq
MIRT2139925	hsa-miR-4254	CLIP-seq
MIRT1465084	hsa-miR-4436a	CLIP-seq
MIRT2139926	hsa-miR-4436b-3p	CLIP-seq
MIRT1465085	hsa-miR-4452	CLIP-seq
MIRT2139927	hsa-miR-4693-5p	CLIP-seq
MIRT2139928	hsa-miR-4696	CLIP-seq
MIRT2139929	hsa-miR-4722-5p	CLIP-seq
MIRT2139930	hsa-miR-4761-3p	CLIP-seq
MIRT2139931	hsa-miR-544	CLIP-seq
MIRT2139932	hsa-miR-873	CLIP-seq
MIRT1465074	hsa-miR-28-3p	CLIP-seq
MIRT1465078	hsa-miR-330-3p	CLIP-seq
MIRT1465079	hsa-miR-3617	CLIP-seq
MIRT1465082	hsa-miR-3913-3p	CLIP-seq
MIRT1465084	hsa-miR-4436a	CLIP-seq
MIRT1465085	hsa-miR-4452	CLIP-seq
MIRT1465089	hsa-miR-4773	CLIP-seq
MIRT1465090	hsa-miR-582-5p	CLIP-seq
MIRT1465091	hsa-miR-641	CLIP-seq
MIRT2654007	hsa-miR-1197	CLIP-seq
MIRT2654008	hsa-miR-217	CLIP-seq
MIRT2654009	hsa-miR-548m	CLIP-seq
MIRT2139932	hsa-miR-873	CLIP-seq
MIRT2654007	hsa-miR-1197	CLIP-seq
MIRT2694538	hsa-miR-1207-5p	CLIP-seq
MIRT2694539	hsa-miR-1208	CLIP-seq
MIRT2139919	hsa-miR-1286	CLIP-seq
MIRT2694540	hsa-miR-192	CLIP-seq
MIRT2694541	hsa-miR-215	CLIP-seq
MIRT2654008	hsa-miR-217	CLIP-seq
MIRT1465074	hsa-miR-28-3p	CLIP-seq
MIRT2694542	hsa-miR-34b	CLIP-seq
MIRT2694543	hsa-miR-3614-5p	CLIP-seq
MIRT1465079	hsa-miR-3617	CLIP-seq
MIRT1465082	hsa-miR-3913-3p	CLIP-seq
MIRT2694544	hsa-miR-4318	CLIP-seq
MIRT1465084	hsa-miR-4436a	CLIP-seq
MIRT1465085	hsa-miR-4452	CLIP-seq
MIRT2694545	hsa-miR-4736	CLIP-seq
MIRT2694546	hsa-miR-4757-5p	CLIP-seq
MIRT2694547	hsa-miR-4763-3p	CLIP-seq
MIRT1465089	hsa-miR-4773	CLIP-seq
MIRT2654009	hsa-miR-548m	CLIP-seq
MIRT1465091	hsa-miR-641	CLIP-seq
MIRT2694548	hsa-miR-663b	CLIP-seq
MIRT2139932	hsa-miR-873	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IDA	14607844
GO:0005515	Function	Protein binding	IPI	14607844, 21044950, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	14607844
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	14607844
GO:0047134	Function	Protein-disulfide reductase [NAD(P)H] activity	IBA
GO:0047134	Function	Protein-disulfide reductase [NAD(P)H] activity	IDA	14607844, 15355959, 18579519
GO:0047134	Function	Protein-disulfide reductase [NAD(P)H] activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
616967	28218	ENSG00000129235

Q9BRA2

Protein name

Thioredoxin domain-containing protein 17 (14 kDa thioredoxin-related protein) (TRP14) (Protein 42-9-9) (Thioredoxin-like protein 5)

Protein function

Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activati

PDB

1WOU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06110	DUF953	8 → 122	Eukaryotic protein of unknown function (DUF953)	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in cell lines. {ECO:0000269|PubMed:14607844}.

Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED

Sequence length

123

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31524236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31524236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28498513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28498513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31524236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25607466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only

TXNDC17 (thioredoxin domain containing 17)