Gene Gene information from NCBI Gene database.
Entrez ID 8481
Gene name OFD1 centriole and centriolar satellite protein
Gene symbol OFD1
Synonyms (NCBI Gene)
71-7ACXorf5JBTS10RP23SGBS2
Chromosome X
Chromosome location Xp22.2
Summary This gene is located on the X chromosome and encodes a centrosomal protein. A knockout mouse model has been used to study the effect of mutations in this gene. The mouse gene is also located on the X chromosome, however, unlike the human gene it is not su
SNPs SNP information provided by dbSNP.
127
SNP ID Visualize variation Clinical significance Consequence
rs122460150 A>C Pathogenic Coding sequence variant, missense variant
rs139444990 G>A Conflicting-interpretations-of-pathogenicity Missense variant, upstream transcript variant, coding sequence variant, 5 prime UTR variant, genic upstream transcript variant
rs143954823 C>G Conflicting-interpretations-of-pathogenicity, likely-benign, benign Missense variant, coding sequence variant
rs199902986 A>G Conflicting-interpretations-of-pathogenicity Upstream transcript variant, genic upstream transcript variant, intron variant, splice acceptor variant
rs201675886 T>C Conflicting-interpretations-of-pathogenicity Genic upstream transcript variant, intron variant, 5 prime UTR variant, coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
6
miRTarBase ID miRNA Experiments Reference
MIRT029155 hsa-miR-26b-5p Microarray 19088304
MIRT050901 hsa-miR-17-5p CLASH 23622248
MIRT2286724 hsa-miR-1253 CLIP-seq
MIRT2286725 hsa-miR-4434 CLIP-seq
MIRT2286726 hsa-miR-4516 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle ISS
GO:0005515 Function Protein binding IPI 17761535, 19800048, 20835237, 21988832, 23789104, 24089205, 24997988, 26496610, 26638075, 33368531, 33934390
GO:0005576 Component Extracellular region IEA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300170 2567 ENSG00000046651
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75665
Protein name Centriole and centriolar satellite protein OFD1 (Oral-facial-digital syndrome 1 protein) (Protein 71-7A)
Protein function Component of the centrioles controlling mother and daughter centrioles length. Recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164 (By similarity). Involved in the biogenesis of the cilium, a centrio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16045 LisH_2 74 101 LisH Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in 9 and 14 weeks old embryos in metanephric mesenchyme, oral mucosa, lung, heart, nasal and cranial cartilage, and brain. Expressed in metanephros, brain, tongue, and limb. {ECO:0000269|PubMed:12595504}.
Sequence
MMAQSNMFTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPR
SISVEGSSLLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPT
SSLYKSLVSGSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLID
DQFADAYPQRIKFESLEIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEK
ELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGRE
AELKQRVEAFELNQKLQEEKHKSITEALRRQEQNIKSFEETYDRKLKNELLKYQLELKDD
YIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAI
TKQNHMLNEKVKEMSDYSLLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELA
VFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVA
DLKLQLKQTQTALENEVYCNPKQSVIDRSVNGLINGNVVPCNGEISGDFLNNPFKQENVL
ARMVASRITNYPTAWVEGSSPDSDLEFVANTKARVKELQQEAERLEKAFRSYHRRVIKNS
AKSPLAAKSPPSLHLLEAFKNITSSSPERHIFGEDRVVSEQPQVGTLEERNDVVEALTGS
AASRLRGGTSSRRLSSTPLPKAKRSLESEMYLEGLGRSHIASPSPCPDRMPLPSPTESRH
SLSIPPVSSPPEQKVGLYRRQTELQDKSEFSDVDKLAFKDNEEFESSFESAGNMPRQLEM
GGLSPAGDMSHVDAAAAAVPLSYQHPSVDQKQIEEQKEEEKIREQQVKERRQREERRQSN
LQEVLERERRELEKLYQERKMIEESLKIKIKKELEMENELEMSNQEIKDKSAHSENPLEK
YMKIIQQEQDQESADKSSKKMVQEGSLVDTLQSSDKVESLTGFSHEELDDSW
Sequence length 1012
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Hedgehog 'off' state
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
62
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cerebellar vermis hypoplasia Likely pathogenic rs2047914412 RCV001391275
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COACH syndrome Pathogenic rs312262845 RCV002463622
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Joubert syndrome Pathogenic; Likely pathogenic rs312262809, rs2147082213, rs2147016815, rs2146984250, rs2518886212, rs2518940054, rs750227810, rs797044945, rs2518959653, rs863225212, rs983722470, rs766872363, rs1252017658, rs2518759610, rs2518924877
View all (28 more)
RCV001380141
RCV001387144
RCV001977855
RCV001946980
RCV005215922
View all (38 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Joubert syndrome 10 Pathogenic; Likely pathogenic rs2147027077, rs2147060430, rs863225211, rs863225212, rs312262895, rs312262894, rs2518939102, rs1131691889, rs398122866, rs312262868, rs312262810, rs312262830, rs312262845, rs2047914412, rs2047299277 RCV001535950
RCV001806695
RCV000201699
RCV000201562
RCV000012300
View all (10 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal nail morphology Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bifid nail Uncertain significance ClinVar
Disgenet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
CAKUT Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cerebral arteriopathy, autosomal dominant, with subcortical infarcts and leukoencephalopathy, type 1 Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired porencephaly Acquired Porencephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Alopecia Alopecia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anodontia of Permanent Dentition Anodontia HPO_DG
★☆☆☆☆
Found in Text Mining only
Arachnoid Cysts Arachnoid cyst HPO_DG
★☆☆☆☆
Found in Text Mining only
Asthenozoospermia Asthenozoospermia HPO_DG
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 32193494 Associate
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 36833254 Associate
★☆☆☆☆
Found in Text Mining only
Bardet-Biedl syndrome 4 (disorder) Bardet-Biedl Syndrome BEFREE 24691443
★☆☆☆☆
Found in Text Mining only