Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84765
Gene name	Zinc finger protein 577
Gene symbol	ZNF577
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.41

Show/Hide all (99)

miRTarBase ID	miRNA	Experiments
MIRT1530289	hsa-miR-4503	CLIP-seq
MIRT1530290	hsa-miR-513a-3p	CLIP-seq
MIRT1530291	hsa-miR-599	CLIP-seq
MIRT1530292	hsa-miR-106a	CLIP-seq
MIRT1530293	hsa-miR-106b	CLIP-seq
MIRT1530294	hsa-miR-1321	CLIP-seq
MIRT1530295	hsa-miR-150	CLIP-seq
MIRT1530296	hsa-miR-17	CLIP-seq
MIRT1530297	hsa-miR-20a	CLIP-seq
MIRT1530298	hsa-miR-20b	CLIP-seq
MIRT1530299	hsa-miR-302a	CLIP-seq
MIRT1530300	hsa-miR-302b	CLIP-seq
MIRT1530301	hsa-miR-302c	CLIP-seq
MIRT1530302	hsa-miR-302d	CLIP-seq
MIRT1530303	hsa-miR-302e	CLIP-seq
MIRT1530304	hsa-miR-3074-5p	CLIP-seq
MIRT1530305	hsa-miR-3152-5p	CLIP-seq
MIRT1530306	hsa-miR-3162-5p	CLIP-seq
MIRT1530307	hsa-miR-372	CLIP-seq
MIRT1530308	hsa-miR-373	CLIP-seq
MIRT1530309	hsa-miR-3934	CLIP-seq
MIRT1530310	hsa-miR-3942-3p	CLIP-seq
MIRT1530311	hsa-miR-410	CLIP-seq
MIRT1530312	hsa-miR-4307	CLIP-seq
MIRT1530313	hsa-miR-4312	CLIP-seq
MIRT1530314	hsa-miR-4662a-3p	CLIP-seq
MIRT1530315	hsa-miR-4663	CLIP-seq
MIRT1530316	hsa-miR-4722-3p	CLIP-seq
MIRT1530317	hsa-miR-4739	CLIP-seq
MIRT1530318	hsa-miR-4756-5p	CLIP-seq
MIRT1530319	hsa-miR-4757-5p	CLIP-seq
MIRT1530320	hsa-miR-4775	CLIP-seq
MIRT1530321	hsa-miR-5095	CLIP-seq
MIRT1530322	hsa-miR-512-3p	CLIP-seq
MIRT1530323	hsa-miR-519d	CLIP-seq
MIRT1530324	hsa-miR-520a-3p	CLIP-seq
MIRT1530325	hsa-miR-520b	CLIP-seq
MIRT1530326	hsa-miR-520c-3p	CLIP-seq
MIRT1530327	hsa-miR-520d-3p	CLIP-seq
MIRT1530328	hsa-miR-520e	CLIP-seq
MIRT1530329	hsa-miR-520g	CLIP-seq
MIRT1530330	hsa-miR-520h	CLIP-seq
MIRT1530331	hsa-miR-552	CLIP-seq
MIRT1530332	hsa-miR-587	CLIP-seq
MIRT1530333	hsa-miR-93	CLIP-seq
MIRT1530292	hsa-miR-106a	CLIP-seq
MIRT1530293	hsa-miR-106b	CLIP-seq
MIRT2160317	hsa-miR-128	CLIP-seq
MIRT2160318	hsa-miR-1293	CLIP-seq
MIRT1530296	hsa-miR-17	CLIP-seq
MIRT2160319	hsa-miR-1915	CLIP-seq
MIRT1530297	hsa-miR-20a	CLIP-seq
MIRT1530298	hsa-miR-20b	CLIP-seq
MIRT1530299	hsa-miR-302a	CLIP-seq
MIRT1530300	hsa-miR-302b	CLIP-seq
MIRT1530301	hsa-miR-302c	CLIP-seq
MIRT1530302	hsa-miR-302d	CLIP-seq
MIRT1530303	hsa-miR-302e	CLIP-seq
MIRT2160320	hsa-miR-323-5p	CLIP-seq
MIRT2160321	hsa-miR-371-5p	CLIP-seq
MIRT2160322	hsa-miR-371b-5p	CLIP-seq
MIRT1530307	hsa-miR-372	CLIP-seq
MIRT1530308	hsa-miR-373	CLIP-seq
MIRT1530309	hsa-miR-3934	CLIP-seq
MIRT2160323	hsa-miR-4423-5p	CLIP-seq
MIRT2160324	hsa-miR-4483	CLIP-seq
MIRT1530315	hsa-miR-4663	CLIP-seq
MIRT2160325	hsa-miR-4781-3p	CLIP-seq
MIRT1530321	hsa-miR-5095	CLIP-seq
MIRT1530322	hsa-miR-512-3p	CLIP-seq
MIRT1530323	hsa-miR-519d	CLIP-seq
MIRT1530324	hsa-miR-520a-3p	CLIP-seq
MIRT1530325	hsa-miR-520b	CLIP-seq
MIRT1530326	hsa-miR-520c-3p	CLIP-seq
MIRT1530327	hsa-miR-520d-3p	CLIP-seq
MIRT1530328	hsa-miR-520e	CLIP-seq
MIRT1530331	hsa-miR-552	CLIP-seq
MIRT1530333	hsa-miR-93	CLIP-seq
MIRT2671637	hsa-miR-219-1-3p	CLIP-seq
MIRT2671638	hsa-miR-335	CLIP-seq
MIRT2671639	hsa-miR-3925-3p	CLIP-seq
MIRT2671640	hsa-miR-4424	CLIP-seq
MIRT2671641	hsa-miR-4461	CLIP-seq
MIRT2671642	hsa-miR-4659a-5p	CLIP-seq
MIRT2671643	hsa-miR-4659b-5p	CLIP-seq
MIRT2671644	hsa-miR-4710	CLIP-seq
MIRT1530320	hsa-miR-4775	CLIP-seq
MIRT2671645	hsa-miR-4776-3p	CLIP-seq
MIRT2671646	hsa-miR-4792	CLIP-seq
MIRT2671647	hsa-miR-498	CLIP-seq
MIRT2671648	hsa-miR-548u	CLIP-seq
MIRT2671649	hsa-miR-550b	CLIP-seq
MIRT2671650	hsa-miR-571	CLIP-seq
MIRT2671651	hsa-miR-617	CLIP-seq
MIRT2671652	hsa-miR-766	CLIP-seq
MIRT2671639	hsa-miR-3925-3p	CLIP-seq
MIRT2671648	hsa-miR-548u	CLIP-seq
MIRT2671651	hsa-miR-617	CLIP-seq
MIRT2671652	hsa-miR-766	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	31403225
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BSK1

Protein name

Zinc finger protein 577

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	22 → 63	KRAB box	Family
PF00096	zf-C2H2	158 → 179	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	188 → 208	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	214 → 236	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	242 → 264	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	270 → 292	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	298 → 320	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	326 → 348	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	354 → 376	Zinc finger, C2H2 type	Domain

Sequence

MKNATIVMSVRREQGSSSGEGSLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYINLV
SIGYRGTKPDSLFKLEQGEPPGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLH
IKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTE
RGEKPHGCGECGKTFMRKIQLTEHQRTHTGEKPHECSECGKAFSRKSQLMVHQRTHTGEK
PYRCSKCGKAFSRKCRLNRHQRSHTGEKLYGCSVCGKAFSQKAYLTAHQRLHTGDKPYKC
SDCGRTFYFKSDLTRHQRIHTGEKPYECSECEKAFRSKSKLIQHQRTHTGERPYSCRECG
KAFAHMSVLIKHEKTHIRETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSS
GTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSVINYILYLT
DIVSE

Sequence length

485

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22143938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	24322204		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21424380, 24528085, 32390948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22143938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	GWASCAT_DG	30818990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32390948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21821860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34944472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22143938		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF577 (zinc finger protein 577)