OGT (O-linked N-acetylglucosamine (GlcNAc) transferase)

Gene

• Entrez ID: 8473
• Gene name: O-linked N-acetylglucosamine (GlcNAc) transferase
• Gene symbol: OGT
• Synonyms (NCBI Gene): HINCUT-1, HRNT1, MRX106, O-GLCNAC, OGT1, XLID106
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs797044898	G>A	Uncertain-significance, pathogenic	Intron variant, missense variant, coding sequence variant
rs943295842	T>C,G	Pathogenic	Intron variant
rs1114167891	G>C	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1131692155	G>C,T	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1602147880	A>G	Pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant
rs1602152230	A>T	Pathogenic	Coding sequence variant, missense variant
rs1602155923	C>T	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050178	hsa-miR-26a-5p	CLASH	23622248
MIRT049427	hsa-miR-92a-3p	CLASH	23622248
MIRT045697	hsa-miR-125a-5p	CLASH	23622248
MIRT039274	hsa-miR-671-5p	CLASH	23622248
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT110054	hsa-miR-107	PAR-CLIP	20371350
MIRT110056	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT110052	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT110057	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT110059	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT110060	hsa-miR-3154	PAR-CLIP	20371350
MIRT110062	hsa-miR-4688	PAR-CLIP	20371350
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	20371350
MIRT110061	hsa-miR-3179	PAR-CLIP	20371350
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT039274	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT110058	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT110078	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT110074	hsa-miR-3616-3p	PAR-CLIP	20371350
MIRT574547	hsa-miR-4721	PAR-CLIP	20371350
MIRT110072	hsa-miR-1256	PAR-CLIP	20371350
MIRT574546	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT110071	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT574545	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT110063	hsa-miR-6079	PAR-CLIP	20371350
MIRT574544	hsa-miR-4287	PAR-CLIP	20371350
MIRT574543	hsa-miR-512-5p	PAR-CLIP	20371350
MIRT176071	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT176070	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT110054	hsa-miR-107	PAR-CLIP	21572407
MIRT110056	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT110052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT110057	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT110059	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT110060	hsa-miR-3154	PAR-CLIP	21572407
MIRT110062	hsa-miR-4688	PAR-CLIP	21572407
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	21572407
MIRT176072	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT110061	hsa-miR-3179	PAR-CLIP	21572407
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT039274	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT110058	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT110054	hsa-miR-107	PAR-CLIP	21572407
MIRT110056	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT110052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT110057	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT110059	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT110060	hsa-miR-3154	PAR-CLIP	21572407
MIRT110062	hsa-miR-4688	PAR-CLIP	21572407
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	21572407
MIRT176072	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT110061	hsa-miR-3179	PAR-CLIP	21572407
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT039274	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT110058	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT110063	hsa-miR-6079	PAR-CLIP	21572407
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT176071	hsa-miR-200a-3p	PAR-CLIP	23446348
MIRT176070	hsa-miR-141-3p	PAR-CLIP	23446348
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT110054	hsa-miR-107	PAR-CLIP	23446348
MIRT110056	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT110052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT110057	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT110059	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT176076	hsa-miR-6757-3p	PAR-CLIP	23446348
MIRT110060	hsa-miR-3154	PAR-CLIP	23446348
MIRT110062	hsa-miR-4688	PAR-CLIP	23446348
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	23446348
MIRT110061	hsa-miR-3179	PAR-CLIP	23446348
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT039274	hsa-miR-671-5p	PAR-CLIP	23446348
MIRT110058	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT110063	hsa-miR-6079	PAR-CLIP	23446348
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT366932	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT366928	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT366936	hsa-miR-9500	PAR-CLIP	23592263
MIRT471756	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT471754	hsa-miR-4270	PAR-CLIP	23592263
MIRT471755	hsa-miR-4441	PAR-CLIP	23592263
MIRT471753	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT366933	hsa-miR-5093	PAR-CLIP	23592263
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	23592263
MIRT366931	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT366929	hsa-miR-3153	PAR-CLIP	23592263
MIRT366934	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT366935	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	23592263
MIRT471752	hsa-miR-4271	PAR-CLIP	23592263
MIRT471751	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT445707	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT445706	hsa-miR-5702	PAR-CLIP	22100165
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	22100165
MIRT449611	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445704	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445703	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	22100165
MIRT229911	hsa-miR-8081	PAR-CLIP	22100165
MIRT445707	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT445706	hsa-miR-5702	PAR-CLIP	22100165
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	22100165
MIRT445704	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445703	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	22100165
MIRT229911	hsa-miR-8081	PAR-CLIP	22100165
MIRT440065	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440064	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT110051	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT110055	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT110052	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT110056	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT440065	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440064	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT110054	hsa-miR-107	PAR-CLIP	20371350
MIRT110056	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT110052	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT110057	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT110059	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT110060	hsa-miR-3154	PAR-CLIP	20371350
MIRT110062	hsa-miR-4688	PAR-CLIP	20371350
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	20371350
MIRT110061	hsa-miR-3179	PAR-CLIP	20371350
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT039274	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT110058	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT110078	hsa-miR-4761-3p	PAR-CLIP	20371350
MIRT110074	hsa-miR-3616-3p	PAR-CLIP	20371350
MIRT574547	hsa-miR-4721	PAR-CLIP	20371350
MIRT110072	hsa-miR-1256	PAR-CLIP	20371350
MIRT574546	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT110071	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT574545	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT110063	hsa-miR-6079	PAR-CLIP	20371350
MIRT574544	hsa-miR-4287	PAR-CLIP	20371350
MIRT574543	hsa-miR-512-5p	PAR-CLIP	20371350
MIRT176071	hsa-miR-200a-3p	PAR-CLIP	21572407
MIRT176070	hsa-miR-141-3p	PAR-CLIP	21572407
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT110054	hsa-miR-107	PAR-CLIP	21572407
MIRT110056	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT110052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT110057	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT110059	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT110060	hsa-miR-3154	PAR-CLIP	21572407
MIRT110062	hsa-miR-4688	PAR-CLIP	21572407
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	21572407
MIRT176072	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT110061	hsa-miR-3179	PAR-CLIP	21572407
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT039274	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT110058	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT110054	hsa-miR-107	PAR-CLIP	21572407
MIRT110056	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT110052	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT110057	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT110059	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT110060	hsa-miR-3154	PAR-CLIP	21572407
MIRT110062	hsa-miR-4688	PAR-CLIP	21572407
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	21572407
MIRT176072	hsa-miR-34c-3p	PAR-CLIP	21572407
MIRT110061	hsa-miR-3179	PAR-CLIP	21572407
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	21572407
MIRT039274	hsa-miR-671-5p	PAR-CLIP	21572407
MIRT110058	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT110063	hsa-miR-6079	PAR-CLIP	21572407
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT176071	hsa-miR-200a-3p	PAR-CLIP	23446348
MIRT176070	hsa-miR-141-3p	PAR-CLIP	23446348
MIRT110053	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT110054	hsa-miR-107	PAR-CLIP	23446348
MIRT110056	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT110052	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT110057	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT110059	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT110055	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT110067	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT110051	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT176076	hsa-miR-6757-3p	PAR-CLIP	23446348
MIRT110060	hsa-miR-3154	PAR-CLIP	23446348
MIRT110062	hsa-miR-4688	PAR-CLIP	23446348
MIRT110065	hsa-miR-6743-5p	PAR-CLIP	23446348
MIRT110061	hsa-miR-3179	PAR-CLIP	23446348
MIRT110066	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT039274	hsa-miR-671-5p	PAR-CLIP	23446348
MIRT110058	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT110063	hsa-miR-6079	PAR-CLIP	23446348
MIRT506328	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT366932	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT366928	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT366936	hsa-miR-9500	PAR-CLIP	23592263
MIRT471756	hsa-miR-211-3p	PAR-CLIP	23592263
MIRT471754	hsa-miR-4270	PAR-CLIP	23592263
MIRT471755	hsa-miR-4441	PAR-CLIP	23592263
MIRT471753	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT366933	hsa-miR-5093	PAR-CLIP	23592263
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	23592263
MIRT366931	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT366929	hsa-miR-3153	PAR-CLIP	23592263
MIRT366934	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT366935	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	23592263
MIRT471752	hsa-miR-4271	PAR-CLIP	23592263
MIRT471751	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT445707	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT445706	hsa-miR-5702	PAR-CLIP	22100165
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	22100165
MIRT449611	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445704	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445703	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	22100165
MIRT229911	hsa-miR-8081	PAR-CLIP	22100165
MIRT445707	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT445706	hsa-miR-5702	PAR-CLIP	22100165
MIRT445705	hsa-miR-3619-3p	PAR-CLIP	22100165
MIRT445704	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445703	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445702	hsa-miR-4776-5p	PAR-CLIP	22100165
MIRT229911	hsa-miR-8081	PAR-CLIP	22100165
MIRT110057	hsa-miR-424-5p	Luciferase reporter assay, Western blotting, in vitro cullelar assays	34680309
MIRT1202781	hsa-miR-103a	CLIP-seq
MIRT1202782	hsa-miR-1183	CLIP-seq
MIRT1202783	hsa-miR-1226	CLIP-seq
MIRT1202784	hsa-miR-1264	CLIP-seq
MIRT1202785	hsa-miR-1265	CLIP-seq
MIRT1202786	hsa-miR-1271	CLIP-seq
MIRT1202787	hsa-miR-1286	CLIP-seq
MIRT1202788	hsa-miR-140-5p	CLIP-seq
MIRT1202789	hsa-miR-15a	CLIP-seq
MIRT1202790	hsa-miR-15b	CLIP-seq
MIRT1202791	hsa-miR-16	CLIP-seq
MIRT1202792	hsa-miR-182	CLIP-seq
MIRT1202793	hsa-miR-195	CLIP-seq
MIRT1202794	hsa-miR-2052	CLIP-seq
MIRT1202795	hsa-miR-2114	CLIP-seq
MIRT1202796	hsa-miR-2276	CLIP-seq
MIRT1202797	hsa-miR-2392	CLIP-seq
MIRT1202798	hsa-miR-299-5p	CLIP-seq
MIRT1202799	hsa-miR-3137	CLIP-seq
MIRT1202800	hsa-miR-3148	CLIP-seq
MIRT1202801	hsa-miR-3155	CLIP-seq
MIRT1202802	hsa-miR-3155b	CLIP-seq
MIRT1202803	hsa-miR-3162-3p	CLIP-seq
MIRT1202804	hsa-miR-3163	CLIP-seq
MIRT1202805	hsa-miR-3167	CLIP-seq
MIRT1202806	hsa-miR-3180-5p	CLIP-seq
MIRT1202807	hsa-miR-329	CLIP-seq
MIRT1202808	hsa-miR-339-5p	CLIP-seq
MIRT1202809	hsa-miR-340	CLIP-seq
MIRT1202810	hsa-miR-3617	CLIP-seq
MIRT1202811	hsa-miR-362-3p	CLIP-seq
MIRT1202812	hsa-miR-3650	CLIP-seq
MIRT1202813	hsa-miR-3653	CLIP-seq
MIRT1202814	hsa-miR-3663-5p	CLIP-seq
MIRT1202815	hsa-miR-3680	CLIP-seq
MIRT1202816	hsa-miR-3686	CLIP-seq
MIRT1202817	hsa-miR-3687	CLIP-seq
MIRT1202818	hsa-miR-3941	CLIP-seq
MIRT1202819	hsa-miR-424	CLIP-seq
MIRT1202820	hsa-miR-4307	CLIP-seq
MIRT1202821	hsa-miR-4328	CLIP-seq
MIRT1202822	hsa-miR-4442	CLIP-seq
MIRT1202823	hsa-miR-4476	CLIP-seq
MIRT1202824	hsa-miR-4477a	CLIP-seq
MIRT1202825	hsa-miR-4477b	CLIP-seq
MIRT1202826	hsa-miR-4496	CLIP-seq
MIRT1202827	hsa-miR-4652-3p	CLIP-seq
MIRT1202828	hsa-miR-466	CLIP-seq
MIRT1202829	hsa-miR-4672	CLIP-seq
MIRT1202830	hsa-miR-4686	CLIP-seq
MIRT1202831	hsa-miR-4696	CLIP-seq
MIRT1202832	hsa-miR-4698	CLIP-seq
MIRT1202833	hsa-miR-4700-3p	CLIP-seq
MIRT1202834	hsa-miR-4705	CLIP-seq
MIRT1202835	hsa-miR-4719	CLIP-seq
MIRT1202836	hsa-miR-4722-5p	CLIP-seq
MIRT1202837	hsa-miR-4729	CLIP-seq
MIRT1202838	hsa-miR-4743	CLIP-seq
MIRT1202839	hsa-miR-4766-5p	CLIP-seq
MIRT1202840	hsa-miR-4772-3p	CLIP-seq
MIRT1202841	hsa-miR-4773	CLIP-seq
MIRT1202842	hsa-miR-4775	CLIP-seq
MIRT1202843	hsa-miR-484	CLIP-seq
MIRT1202844	hsa-miR-494	CLIP-seq
MIRT1202845	hsa-miR-497	CLIP-seq
MIRT1202846	hsa-miR-501-3p	CLIP-seq
MIRT1202847	hsa-miR-502-3p	CLIP-seq
MIRT1202848	hsa-miR-520a-5p	CLIP-seq
MIRT1202849	hsa-miR-525-5p	CLIP-seq
MIRT1202850	hsa-miR-544	CLIP-seq
MIRT1202851	hsa-miR-545	CLIP-seq
MIRT1202852	hsa-miR-548aa	CLIP-seq
MIRT1202853	hsa-miR-548ag	CLIP-seq
MIRT1202854	hsa-miR-548ai	CLIP-seq
MIRT1202855	hsa-miR-548u	CLIP-seq
MIRT1202856	hsa-miR-556-3p	CLIP-seq
MIRT1202857	hsa-miR-567	CLIP-seq
MIRT1202858	hsa-miR-579	CLIP-seq
MIRT1202859	hsa-miR-600	CLIP-seq
MIRT1202860	hsa-miR-603	CLIP-seq
MIRT1202861	hsa-miR-619	CLIP-seq
MIRT1202862	hsa-miR-624	CLIP-seq
MIRT1202863	hsa-miR-634	CLIP-seq
MIRT1202864	hsa-miR-641	CLIP-seq
MIRT1202865	hsa-miR-664	CLIP-seq
MIRT1202866	hsa-miR-7	CLIP-seq
MIRT1202867	hsa-miR-759	CLIP-seq
MIRT1202868	hsa-miR-767-5p	CLIP-seq
MIRT1202869	hsa-miR-875-3p	CLIP-seq
MIRT1202870	hsa-miR-876-5p	CLIP-seq
MIRT1202871	hsa-miR-96	CLIP-seq
MIRT1202781	hsa-miR-103a	CLIP-seq
MIRT1202783	hsa-miR-1226	CLIP-seq
MIRT1202784	hsa-miR-1264	CLIP-seq
MIRT1202872	hsa-miR-1304	CLIP-seq
MIRT1202788	hsa-miR-140-5p	CLIP-seq
MIRT1202873	hsa-miR-141	CLIP-seq
MIRT1202789	hsa-miR-15a	CLIP-seq
MIRT1202790	hsa-miR-15b	CLIP-seq
MIRT1202791	hsa-miR-16	CLIP-seq
MIRT1202793	hsa-miR-195	CLIP-seq
MIRT1202874	hsa-miR-200a	CLIP-seq
MIRT1202875	hsa-miR-204	CLIP-seq
MIRT1202876	hsa-miR-211	CLIP-seq
MIRT1202795	hsa-miR-2114	CLIP-seq
MIRT1202877	hsa-miR-24	CLIP-seq
MIRT1202878	hsa-miR-2467-5p	CLIP-seq
MIRT1202798	hsa-miR-299-5p	CLIP-seq
MIRT1202799	hsa-miR-3137	CLIP-seq
MIRT1202804	hsa-miR-3163	CLIP-seq
MIRT1202879	hsa-miR-3188	CLIP-seq
MIRT1202807	hsa-miR-329	CLIP-seq
MIRT1202880	hsa-miR-338-5p	CLIP-seq
MIRT1202808	hsa-miR-339-5p	CLIP-seq
MIRT1202809	hsa-miR-340	CLIP-seq
MIRT1202881	hsa-miR-361-3p	CLIP-seq
MIRT1202811	hsa-miR-362-3p	CLIP-seq
MIRT1202882	hsa-miR-3662	CLIP-seq
MIRT1202883	hsa-miR-3679-3p	CLIP-seq
MIRT1202816	hsa-miR-3686	CLIP-seq
MIRT1202817	hsa-miR-3687	CLIP-seq
MIRT1202884	hsa-miR-380	CLIP-seq
MIRT1202818	hsa-miR-3941	CLIP-seq
MIRT1202885	hsa-miR-3974	CLIP-seq
MIRT1202886	hsa-miR-3975	CLIP-seq
MIRT1202819	hsa-miR-424	CLIP-seq
MIRT1202887	hsa-miR-4299	CLIP-seq
MIRT1202820	hsa-miR-4307	CLIP-seq
MIRT1202822	hsa-miR-4442	CLIP-seq
MIRT1202888	hsa-miR-4459	CLIP-seq
MIRT1202889	hsa-miR-4495	CLIP-seq
MIRT1202827	hsa-miR-4652-3p	CLIP-seq
MIRT1202828	hsa-miR-466	CLIP-seq
MIRT1202829	hsa-miR-4672	CLIP-seq
MIRT1202890	hsa-miR-4687-3p	CLIP-seq
MIRT1202835	hsa-miR-4719	CLIP-seq
MIRT1202838	hsa-miR-4743	CLIP-seq
MIRT1202891	hsa-miR-4755-5p	CLIP-seq
MIRT1202892	hsa-miR-4759	CLIP-seq
MIRT1202893	hsa-miR-485-5p	CLIP-seq
MIRT1202844	hsa-miR-494	CLIP-seq
MIRT1202845	hsa-miR-497	CLIP-seq
MIRT1202851	hsa-miR-545	CLIP-seq
MIRT1202852	hsa-miR-548aa	CLIP-seq
MIRT1202855	hsa-miR-548u	CLIP-seq
MIRT1202857	hsa-miR-567	CLIP-seq
MIRT1202859	hsa-miR-600	CLIP-seq
MIRT1202860	hsa-miR-603	CLIP-seq
MIRT1202894	hsa-miR-607	CLIP-seq
MIRT1202895	hsa-miR-623	CLIP-seq
MIRT1202863	hsa-miR-634	CLIP-seq
MIRT1202896	hsa-miR-665	CLIP-seq
MIRT1202867	hsa-miR-759	CLIP-seq
MIRT2058600	hsa-miR-101	CLIP-seq
MIRT1202781	hsa-miR-103a	CLIP-seq
MIRT2058601	hsa-miR-1270	CLIP-seq
MIRT1202787	hsa-miR-1286	CLIP-seq
MIRT2058602	hsa-miR-134	CLIP-seq
MIRT2058603	hsa-miR-140-3p	CLIP-seq
MIRT2058604	hsa-miR-149	CLIP-seq
MIRT1202789	hsa-miR-15a	CLIP-seq
MIRT1202790	hsa-miR-15b	CLIP-seq
MIRT1202791	hsa-miR-16	CLIP-seq
MIRT1202793	hsa-miR-195	CLIP-seq
MIRT1202795	hsa-miR-2114	CLIP-seq
MIRT1202796	hsa-miR-2276	CLIP-seq
MIRT2058605	hsa-miR-3064-5p	CLIP-seq
MIRT2058606	hsa-miR-3065-5p	CLIP-seq
MIRT2058607	hsa-miR-3118	CLIP-seq
MIRT1202803	hsa-miR-3162-3p	CLIP-seq
MIRT2058608	hsa-miR-3164	CLIP-seq
MIRT1202807	hsa-miR-329	CLIP-seq
MIRT2058609	hsa-miR-330-3p	CLIP-seq
MIRT1202811	hsa-miR-362-3p	CLIP-seq
MIRT2058610	hsa-miR-3671	CLIP-seq
MIRT2058611	hsa-miR-3691-3p	CLIP-seq
MIRT1202818	hsa-miR-3941	CLIP-seq
MIRT1202885	hsa-miR-3974	CLIP-seq
MIRT1202819	hsa-miR-424	CLIP-seq
MIRT1202820	hsa-miR-4307	CLIP-seq
MIRT2058612	hsa-miR-4424	CLIP-seq
MIRT2058613	hsa-miR-4469	CLIP-seq
MIRT1202825	hsa-miR-4477b	CLIP-seq
MIRT2058614	hsa-miR-4528	CLIP-seq
MIRT2058615	hsa-miR-4645-3p	CLIP-seq
MIRT1202828	hsa-miR-466	CLIP-seq
MIRT1202829	hsa-miR-4672	CLIP-seq
MIRT2058616	hsa-miR-4683	CLIP-seq
MIRT2058617	hsa-miR-4685-3p	CLIP-seq
MIRT1202890	hsa-miR-4687-3p	CLIP-seq
MIRT1202833	hsa-miR-4700-3p	CLIP-seq
MIRT1202836	hsa-miR-4722-5p	CLIP-seq
MIRT2058618	hsa-miR-4768-3p	CLIP-seq
MIRT1202840	hsa-miR-4772-3p	CLIP-seq
MIRT2058619	hsa-miR-4794	CLIP-seq
MIRT2058620	hsa-miR-4795-3p	CLIP-seq
MIRT2058621	hsa-miR-4799-5p	CLIP-seq
MIRT1202845	hsa-miR-497	CLIP-seq
MIRT2058622	hsa-miR-499a-5p	CLIP-seq
MIRT2058623	hsa-miR-5095	CLIP-seq
MIRT2058624	hsa-miR-526b	CLIP-seq
MIRT1202856	hsa-miR-556-3p	CLIP-seq
MIRT2058625	hsa-miR-590-3p	CLIP-seq
MIRT2058626	hsa-miR-593	CLIP-seq
MIRT1202859	hsa-miR-600	CLIP-seq
MIRT1202860	hsa-miR-603	CLIP-seq
MIRT2058627	hsa-miR-620	CLIP-seq
MIRT1202781	hsa-miR-103a	CLIP-seq
MIRT2286780	hsa-miR-1243	CLIP-seq
MIRT1202785	hsa-miR-1265	CLIP-seq
MIRT1202872	hsa-miR-1304	CLIP-seq
MIRT1202873	hsa-miR-141	CLIP-seq
MIRT1202789	hsa-miR-15a	CLIP-seq
MIRT1202790	hsa-miR-15b	CLIP-seq
MIRT1202791	hsa-miR-16	CLIP-seq
MIRT2286781	hsa-miR-181a	CLIP-seq
MIRT2286782	hsa-miR-181b	CLIP-seq
MIRT2286783	hsa-miR-181c	CLIP-seq
MIRT2286784	hsa-miR-181d	CLIP-seq
MIRT1202793	hsa-miR-195	CLIP-seq
MIRT1202874	hsa-miR-200a	CLIP-seq
MIRT1202794	hsa-miR-2052	CLIP-seq
MIRT1202796	hsa-miR-2276	CLIP-seq
MIRT1202797	hsa-miR-2392	CLIP-seq
MIRT1202877	hsa-miR-24	CLIP-seq
MIRT1202878	hsa-miR-2467-5p	CLIP-seq
MIRT1202801	hsa-miR-3155	CLIP-seq
MIRT1202802	hsa-miR-3155b	CLIP-seq
MIRT2286785	hsa-miR-3166	CLIP-seq
MIRT1202879	hsa-miR-3188	CLIP-seq
MIRT2286786	hsa-miR-3613-3p	CLIP-seq
MIRT2286787	hsa-miR-3675-3p	CLIP-seq
MIRT1202886	hsa-miR-3975	CLIP-seq
MIRT1202819	hsa-miR-424	CLIP-seq
MIRT2286788	hsa-miR-4262	CLIP-seq
MIRT1202887	hsa-miR-4299	CLIP-seq
MIRT1202820	hsa-miR-4307	CLIP-seq
MIRT1202821	hsa-miR-4328	CLIP-seq
MIRT2286789	hsa-miR-4661-5p	CLIP-seq
MIRT1202830	hsa-miR-4686	CLIP-seq
MIRT1202890	hsa-miR-4687-3p	CLIP-seq
MIRT1202840	hsa-miR-4772-3p	CLIP-seq
MIRT1202841	hsa-miR-4773	CLIP-seq
MIRT1202843	hsa-miR-484	CLIP-seq
MIRT1202893	hsa-miR-485-5p	CLIP-seq
MIRT1202844	hsa-miR-494	CLIP-seq
MIRT1202845	hsa-miR-497	CLIP-seq
MIRT1202851	hsa-miR-545	CLIP-seq
MIRT1202858	hsa-miR-579	CLIP-seq
MIRT1202865	hsa-miR-664	CLIP-seq
MIRT2286790	hsa-miR-891b	CLIP-seq
MIRT1202796	hsa-miR-2276	CLIP-seq
MIRT1202812	hsa-miR-3650	CLIP-seq
MIRT1202840	hsa-miR-4772-3p	CLIP-seq
MIRT2585120	hsa-miR-1178	CLIP-seq
MIRT2585121	hsa-miR-1206	CLIP-seq
MIRT2585122	hsa-miR-1207-3p	CLIP-seq
MIRT2585123	hsa-miR-1208	CLIP-seq
MIRT2585124	hsa-miR-1297	CLIP-seq
MIRT1202872	hsa-miR-1304	CLIP-seq
MIRT2585125	hsa-miR-132	CLIP-seq
MIRT2585126	hsa-miR-154	CLIP-seq
MIRT2286781	hsa-miR-181a	CLIP-seq
MIRT2286782	hsa-miR-181b	CLIP-seq
MIRT2286783	hsa-miR-181c	CLIP-seq
MIRT2286784	hsa-miR-181d	CLIP-seq
MIRT2585127	hsa-miR-188-5p	CLIP-seq
MIRT2585128	hsa-miR-198	CLIP-seq
MIRT1202875	hsa-miR-204	CLIP-seq
MIRT2585129	hsa-miR-205	CLIP-seq
MIRT1202876	hsa-miR-211	CLIP-seq
MIRT2585130	hsa-miR-2116	CLIP-seq
MIRT2585131	hsa-miR-212	CLIP-seq
MIRT1202877	hsa-miR-24	CLIP-seq
MIRT1202878	hsa-miR-2467-5p	CLIP-seq
MIRT2585132	hsa-miR-26a	CLIP-seq
MIRT2585133	hsa-miR-26b	CLIP-seq
MIRT2585134	hsa-miR-3143	CLIP-seq
MIRT2585135	hsa-miR-3145-3p	CLIP-seq
MIRT1202806	hsa-miR-3180-5p	CLIP-seq
MIRT1202879	hsa-miR-3188	CLIP-seq
MIRT1202809	hsa-miR-340	CLIP-seq
MIRT1202881	hsa-miR-361-3p	CLIP-seq
MIRT1202813	hsa-miR-3653	CLIP-seq
MIRT2585136	hsa-miR-3658	CLIP-seq
MIRT1202814	hsa-miR-3663-5p	CLIP-seq
MIRT2585137	hsa-miR-3672	CLIP-seq
MIRT1202883	hsa-miR-3679-3p	CLIP-seq
MIRT1202817	hsa-miR-3687	CLIP-seq
MIRT2058611	hsa-miR-3691-3p	CLIP-seq
MIRT2585138	hsa-miR-371b-5p	CLIP-seq
MIRT2585139	hsa-miR-376c	CLIP-seq
MIRT1202884	hsa-miR-380	CLIP-seq
MIRT2585140	hsa-miR-383	CLIP-seq
MIRT2585141	hsa-miR-3919	CLIP-seq
MIRT2585142	hsa-miR-3929	CLIP-seq
MIRT1202886	hsa-miR-3975	CLIP-seq
MIRT2286788	hsa-miR-4262	CLIP-seq
MIRT2585143	hsa-miR-4269	CLIP-seq
MIRT2585144	hsa-miR-4282	CLIP-seq
MIRT2585145	hsa-miR-4419b	CLIP-seq
MIRT1202822	hsa-miR-4442	CLIP-seq
MIRT2585146	hsa-miR-4465	CLIP-seq
MIRT1202824	hsa-miR-4477a	CLIP-seq
MIRT2585147	hsa-miR-4478	CLIP-seq
MIRT2585148	hsa-miR-4514	CLIP-seq
MIRT2058616	hsa-miR-4683	CLIP-seq
MIRT2585149	hsa-miR-4692	CLIP-seq
MIRT1202832	hsa-miR-4698	CLIP-seq
MIRT1202834	hsa-miR-4705	CLIP-seq
MIRT2585150	hsa-miR-4711-5p	CLIP-seq
MIRT1202835	hsa-miR-4719	CLIP-seq
MIRT2585151	hsa-miR-4724-3p	CLIP-seq
MIRT2585152	hsa-miR-4742-5p	CLIP-seq
MIRT1202838	hsa-miR-4743	CLIP-seq
MIRT1202891	hsa-miR-4755-5p	CLIP-seq
MIRT2585153	hsa-miR-4756-3p	CLIP-seq
MIRT1202840	hsa-miR-4772-3p	CLIP-seq
MIRT2058620	hsa-miR-4795-3p	CLIP-seq
MIRT1202893	hsa-miR-485-5p	CLIP-seq
MIRT2585154	hsa-miR-493	CLIP-seq
MIRT2058622	hsa-miR-499a-5p	CLIP-seq
MIRT1202846	hsa-miR-501-3p	CLIP-seq
MIRT1202847	hsa-miR-502-3p	CLIP-seq
MIRT2585155	hsa-miR-502-5p	CLIP-seq
MIRT1202848	hsa-miR-520a-5p	CLIP-seq
MIRT1202849	hsa-miR-525-5p	CLIP-seq
MIRT2058624	hsa-miR-526b	CLIP-seq
MIRT2585156	hsa-miR-548m	CLIP-seq
MIRT1202857	hsa-miR-567	CLIP-seq
MIRT2585157	hsa-miR-578	CLIP-seq
MIRT2585158	hsa-miR-605	CLIP-seq
MIRT1202895	hsa-miR-623	CLIP-seq
MIRT2585159	hsa-miR-659	CLIP-seq
MIRT1202866	hsa-miR-7	CLIP-seq
MIRT1202868	hsa-miR-767-5p	CLIP-seq
MIRT2286790	hsa-miR-891b	CLIP-seq
MIRT2585120	hsa-miR-1178	CLIP-seq
MIRT2585121	hsa-miR-1206	CLIP-seq
MIRT2585123	hsa-miR-1208	CLIP-seq
MIRT2286780	hsa-miR-1243	CLIP-seq
MIRT2585124	hsa-miR-1297	CLIP-seq
MIRT2585125	hsa-miR-132	CLIP-seq
MIRT2585127	hsa-miR-188-5p	CLIP-seq
MIRT2585128	hsa-miR-198	CLIP-seq
MIRT2585129	hsa-miR-205	CLIP-seq
MIRT2585130	hsa-miR-2116	CLIP-seq
MIRT2585131	hsa-miR-212	CLIP-seq
MIRT1202878	hsa-miR-2467-5p	CLIP-seq
MIRT2585132	hsa-miR-26a	CLIP-seq
MIRT2585133	hsa-miR-26b	CLIP-seq
MIRT2686809	hsa-miR-302a	CLIP-seq
MIRT2686810	hsa-miR-302b	CLIP-seq
MIRT2686811	hsa-miR-302c	CLIP-seq
MIRT2686812	hsa-miR-302d	CLIP-seq
MIRT2686813	hsa-miR-302e	CLIP-seq
MIRT2585134	hsa-miR-3143	CLIP-seq
MIRT2585135	hsa-miR-3145-3p	CLIP-seq
MIRT1202806	hsa-miR-3180-5p	CLIP-seq
MIRT1202879	hsa-miR-3188	CLIP-seq
MIRT1202813	hsa-miR-3653	CLIP-seq
MIRT2585136	hsa-miR-3658	CLIP-seq
MIRT2585137	hsa-miR-3672	CLIP-seq
MIRT1202817	hsa-miR-3687	CLIP-seq
MIRT2058611	hsa-miR-3691-3p	CLIP-seq
MIRT2585138	hsa-miR-371b-5p	CLIP-seq
MIRT2686814	hsa-miR-372	CLIP-seq
MIRT2686815	hsa-miR-373	CLIP-seq
MIRT2585139	hsa-miR-376c	CLIP-seq
MIRT1202884	hsa-miR-380	CLIP-seq
MIRT2585140	hsa-miR-383	CLIP-seq
MIRT2585141	hsa-miR-3919	CLIP-seq
MIRT2585142	hsa-miR-3929	CLIP-seq
MIRT1202886	hsa-miR-3975	CLIP-seq
MIRT2585144	hsa-miR-4282	CLIP-seq
MIRT2585145	hsa-miR-4419b	CLIP-seq
MIRT1202822	hsa-miR-4442	CLIP-seq
MIRT2585146	hsa-miR-4465	CLIP-seq
MIRT1202824	hsa-miR-4477a	CLIP-seq
MIRT2585147	hsa-miR-4478	CLIP-seq
MIRT2058616	hsa-miR-4683	CLIP-seq
MIRT1202832	hsa-miR-4698	CLIP-seq
MIRT1202834	hsa-miR-4705	CLIP-seq
MIRT1202835	hsa-miR-4719	CLIP-seq
MIRT2585151	hsa-miR-4724-3p	CLIP-seq
MIRT1202838	hsa-miR-4743	CLIP-seq
MIRT2585153	hsa-miR-4756-3p	CLIP-seq
MIRT2058620	hsa-miR-4795-3p	CLIP-seq
MIRT1202893	hsa-miR-485-5p	CLIP-seq
MIRT2058622	hsa-miR-499a-5p	CLIP-seq
MIRT2585155	hsa-miR-502-5p	CLIP-seq
MIRT2686816	hsa-miR-519a	CLIP-seq
MIRT2686817	hsa-miR-519b-3p	CLIP-seq
MIRT2686818	hsa-miR-519c-3p	CLIP-seq
MIRT2686819	hsa-miR-520a-3p	CLIP-seq
MIRT1202848	hsa-miR-520a-5p	CLIP-seq
MIRT2686820	hsa-miR-520b	CLIP-seq
MIRT2686821	hsa-miR-520c-3p	CLIP-seq
MIRT2686822	hsa-miR-520d-3p	CLIP-seq
MIRT2686823	hsa-miR-520e	CLIP-seq
MIRT1202849	hsa-miR-525-5p	CLIP-seq
MIRT2585156	hsa-miR-548m	CLIP-seq
MIRT2585158	hsa-miR-605	CLIP-seq
MIRT2585159	hsa-miR-659	CLIP-seq
MIRT1202866	hsa-miR-7	CLIP-seq
MIRT2286790	hsa-miR-891b	CLIP-seq
MIRT1202878	hsa-miR-2467-5p	CLIP-seq
MIRT1202879	hsa-miR-3188	CLIP-seq
MIRT1202886	hsa-miR-3975	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	22865885
GO:0000123	Component	Histone acetyltransferase complex	IDA	20018852
GO:0000423	Process	Mitophagy	IEA
GO:0000423	Process	Mitophagy	ISS	33406421
GO:0000432	Process	Positive regulation of transcription from RNA polymerase II promoter by glucose	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0005515	Function	Protein binding	IPI	12150998, 12670868, 16189514, 17882263, 20200153, 21285374, 21295698, 22923583, 23088713, 23222540, 23353889, 23629655, 24474760, 24995978, 25416956, 25419848, 26678539, 26871637, 27505673, 27705803, 30699359, 32296183, 33961781, 34667079
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	18288188
GO:0005634	Component	Nucleus	IDA	21285374, 26678539, 27713473
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005634	Component	Nucleus	TAS	9083067
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	21285374, 27713473
GO:0005829	Component	Cytosol	TAS	9083067
GO:0005886	Component	Plasma membrane	IDA	18288188
GO:0005886	Component	Plasma membrane	IEA
GO:0006110	Process	Regulation of glycolytic process	IDA	22923583
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006111	Process	Regulation of gluconeogenesis	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	26678539
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0006493	Process	Protein O-linked glycosylation	IDA	21240259, 21285374, 22923583, 23222540, 23352454, 24474760, 30699359
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IMP	23353889
GO:0006493	Process	Protein O-linked glycosylation	TAS	9083067
GO:0006915	Process	Apoptotic process	IDA	20824293
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	9083067
GO:0007584	Process	Response to nutrient	TAS	9083068
GO:0008289	Function	Lipid binding	IEA
GO:0008375	Function	Acetylglucosaminyltransferase activity	TAS	9083068
GO:0016020	Component	Membrane	IEA
GO:0016485	Process	Protein processing	IMP	28584052
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017122	Component	Protein N-acetylglucosaminyltransferase complex	IDA	21240259
GO:0017148	Process	Negative regulation of translation	IDA	34074792
GO:0030097	Process	Hemopoiesis	IEA
GO:0030097	Process	Hemopoiesis	ISS	33406421
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	26678539
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	12150926, 29236692, 29750193, 31601708
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	26678539
GO:0032868	Process	Response to insulin	IDA	18288188
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IDA	26678539
GO:0035020	Process	Regulation of Rac protein signal transduction	IDA	18288188
GO:0038202	Process	TORC1 signaling	IDA	12087098, 12150926, 29750193
GO:0042995	Component	Cell projection	IEA
GO:0044545	Component	NSL complex	IDA	20018852
GO:0045202	Component	Synapse	IEA
GO:0045727	Process	Positive regulation of translation	IDA	34074792
GO:0045862	Process	Positive regulation of proteolysis	IDA	21285374
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	24842875
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23222540, 23353889
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23352454
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046626	Process	Regulation of insulin receptor signaling pathway	IDA	18288188
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051604	Process	Protein maturation	IDA	25119034
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0060544	Process	Regulation of necroptotic process	TAS
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412, 33883744
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:0071333	Process	Cellular response to glucose stimulus	IDA	37541260
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	EXP	30770249
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	IBA
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	IDA	21285374, 23222540, 23352454, 23353889, 24474760, 24563466, 26369908, 27527864, 27713473, 30699359, 31527085, 34074792, 37541260, 37962578
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	IEA
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	IMP	23777819, 26678539, 28584052
GO:0097363	Function	Protein O-acetylglucosaminyltransferase activity	ISS
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28637651
GO:0140694	Process	Membraneless organelle assembly	IDA	34074792
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	25119034
GO:0160076	Process	Negative regulation of non-canonical inflammasome complex assembly	IDA	37962578
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	37541260

Other IDs

• MIM: 300255
• HGNC: 8127
• e!Ensembl: ENSG00000147162

Protein

• UniProt ID: O15294
• Protein name: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (EC 2.4.1.255) (O-GlcNAc transferase subunit p110) (O-linked N-acetylglucosamine transferase 110 kDa subunit) (OGT)
• Protein function: Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc) (PubMed:12150998, PubMe
• PDB: 1W3B, 3PE3, 3PE4, 3TAX, 4AY5, 4AY6, 4CDR, 4GYW, 4GYY, 4GZ3, 4GZ5, 4GZ6, 4N39, 4N3A, 4N3B, 4N3C, 4XI9, 4XIF, 5BNW, 5C1D, 5HGV, 5LVV, 5LWV, 5NPR, 5NPS, 5VIE, 5VIF, 6E37, 6EOU, 6IBO, 6MA1, 6MA2, 6MA3, 6MA4, 6MA5, 6Q4M, 6TKA, 7NTF, 7YEA, 7YEH, 8CM9, 8FE6, 8FE7, 8FUF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13414	TPR_11	96 → 137		Repeat
  PF13181	TPR_8	160 → 190	Tetratricopeptide repeat	Repeat
  PF00515	TPR_1	191 → 224	Tetratricopeptide repeat	Repeat
  PF13181	TPR_8	225 → 258	Tetratricopeptide repeat	Repeat
  PF13181	TPR_8	259 → 292	Tetratricopeptide repeat	Repeat
  PF13424	TPR_12	292 → 359		Repeat
  PF13432	TPR_16	331 → 393		Family
  PF13414	TPR_11	334 → 375		Repeat
  PF13414	TPR_11	370 → 409		Repeat
  PF13414	TPR_11	436 → 474		Repeat
  PF13844	Glyco_transf_41	476 → 1016	Glycosyl transferase family 41	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver. {ECO:0000269|PubMed:9083068}.
• Sequence:

  MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
  LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
  DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
  LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
  FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
  NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
  AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
  AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
  DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
  PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
  FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
  MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
  IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMN
  TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
  AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
  IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
  TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLY
  LQMWEHYAAGNKPDHMIKPVEVTESA

• Sequence length: 1046

Pathways

KEGG:

Other types of O-glycan biosynthesis
Polycomb repressive complex
Insulin resistance

Reactome:

HATs acetylate histones
UCH proteinases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Intellectual disability, X-linked 106	Likely pathogenic; Pathogenic	rs2522869732, rs2522845856, rs1131692155, rs1114167891, rs943295842, rs1602155923, rs1602152230, rs1602147880	RCV002468756 RCV003333603 RCV000492058 RCV000492048 RCV000492053 RCV000850576 RCV000852378 RCV000991239 RCV000991242	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED 106	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OGT-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OGT-related X-linked syndromic intellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	19451179, 21732316, 24859566, 28657654, 29986387, 33285636, 34004049, 34186233	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	27070276	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23592772		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	22128088		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	36345035	Associate	★☆☆☆☆ Found in Text Mining only
Arts syndrome	Arts syndrome	Pubtator	37308732	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	30356792		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24214978, 28929346		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11566258, 21567137, 28929346, 29864144, 30952976, 31019204, 33046784, 33214551, 34575972, 34974534, 40598910	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32236627	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24316969, 27331873, 30052810, 37559097	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30677218, 37247228, 37559097	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32357142	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25315705		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33337348	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36345035	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29641181, 30412832		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	32508185	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23480751, 27290989, 29915392	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24126823, 30484950		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24037088, 27566657, 30093632, 32994395, 37963940	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	35863433	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30962710		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22128088, 26269457, 29641181, 30237786		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37210277	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16105839, 18984734, 22371497, 31864032, 35335358, 37247228	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22128088, 26269457, 29641181, 30237786		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21732316, 29986387, 32508185, 34004049	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20863281, 29525407		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26311324	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30205382		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27716624		★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	20200153	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34948036	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37350405	Stimulate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25663381	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28347804		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31672932		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XIV	Glycogen storage disease	Pubtator	35863433	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34004049	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29864144	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Motor Neuropathy	Hereditary sensory and motor neuropathy	Pubtator	37540114	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	37210277	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29944994		★☆☆☆☆ Found in Text Mining only
Hyperproinsulinemia	Hyperproinsulinemia	BEFREE	31300553		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34004049, 37210277	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24037088	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18984734, 20413512	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28302723, 28584052, 29606577, 29769320, 31628985, 35863433	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31296563, 31627256		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25315705	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32272438	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32272438, 37736724	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	32272438	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27060025, 27175940, 29454068, 30677218		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33199824, 33801653	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21567137, 24214978, 28929346		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	25315705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22664592, 28347804, 31625393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24129563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27530921, 27542217		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24126823, 24865644, 25141978, 29059153, 29556021, 30237786, 30412832		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21567137		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 106	Mental retardation	UNIPROT_DG	26273451, 28302723, 28584052		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 106	Mental retardation	CLINVAR_DG	28584052		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 106	Mental retardation	GENOMICS_ENGLAND_DG	28584052		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30677218	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24713701	Associate	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	27070276	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37736724	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14533811, 14601650, 27542217, 29556021, 29788742		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16105839, 22371497, 32272438, 37247228	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22988095		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29525407, 29944994, 30237786		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	21567137	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24333294	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	24333294	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36544170, 38217543	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27402830	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24129563		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24129563	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32144674	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26824323, 32611550, 35348747, 35708495	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30962710		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27070276	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	22300411	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28347804		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27530921, 27542217		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22988095, 28521765		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30952976	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32174982	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27331873	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30052810	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32508185	Associate	★☆☆☆☆ Found in Text Mining only