Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84722
Gene name	Proline and serine rich coiled-coil 1
Gene symbol	PSRC1
Synonyms (NCBI Gene)	DDA3FP3214
Chromosome	1
Chromosome location	1p13.3
Summary	This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alte

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016342	hsa-miR-193b-3p	Microarray	20304954
MIRT024463	hsa-miR-215-5p	Microarray	19074876
MIRT026297	hsa-miR-192-5p	Microarray	19074876
MIRT044740	hsa-miR-320a	CLASH	23622248
MIRT1271160	hsa-miR-1182	CLIP-seq
MIRT1271161	hsa-miR-1207-5p	CLIP-seq
MIRT1271162	hsa-miR-1264	CLIP-seq
MIRT1271163	hsa-miR-1287	CLIP-seq
MIRT1271164	hsa-miR-1289	CLIP-seq
MIRT1271165	hsa-miR-1321	CLIP-seq
MIRT1271166	hsa-miR-1972	CLIP-seq
MIRT1271167	hsa-miR-27a	CLIP-seq
MIRT1271168	hsa-miR-27b	CLIP-seq
MIRT1271169	hsa-miR-3123	CLIP-seq
MIRT1271170	hsa-miR-3135b	CLIP-seq
MIRT1271171	hsa-miR-3198	CLIP-seq
MIRT1271172	hsa-miR-3616-3p	CLIP-seq
MIRT1271173	hsa-miR-3925-3p	CLIP-seq
MIRT1271174	hsa-miR-3925-5p	CLIP-seq
MIRT1271175	hsa-miR-4257	CLIP-seq
MIRT1271176	hsa-miR-4261	CLIP-seq
MIRT1271177	hsa-miR-4266	CLIP-seq
MIRT1271178	hsa-miR-4267	CLIP-seq
MIRT1271179	hsa-miR-4268	CLIP-seq
MIRT1271180	hsa-miR-4270	CLIP-seq
MIRT1271181	hsa-miR-4294	CLIP-seq
MIRT1271182	hsa-miR-4309	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271184	hsa-miR-4436b-3p	CLIP-seq
MIRT1271185	hsa-miR-4441	CLIP-seq
MIRT1271186	hsa-miR-4496	CLIP-seq
MIRT1271187	hsa-miR-4527	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT1271190	hsa-miR-4686	CLIP-seq
MIRT1271191	hsa-miR-4690-5p	CLIP-seq
MIRT1271192	hsa-miR-4712-5p	CLIP-seq
MIRT1271193	hsa-miR-4739	CLIP-seq
MIRT1271194	hsa-miR-4756-5p	CLIP-seq
MIRT1271195	hsa-miR-4762-3p	CLIP-seq
MIRT1271196	hsa-miR-4763-3p	CLIP-seq
MIRT1271197	hsa-miR-513a-5p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT1271199	hsa-miR-766	CLIP-seq
MIRT1271200	hsa-miR-770-5p	CLIP-seq
MIRT1271201	hsa-miR-873	CLIP-seq
MIRT1271202	hsa-miR-936	CLIP-seq
MIRT1271203	hsa-miR-942	CLIP-seq
MIRT2079749	hsa-miR-181a	CLIP-seq
MIRT2079750	hsa-miR-181b	CLIP-seq
MIRT2079751	hsa-miR-181c	CLIP-seq
MIRT2079752	hsa-miR-181d	CLIP-seq
MIRT2079753	hsa-miR-3163	CLIP-seq
MIRT2079754	hsa-miR-326	CLIP-seq
MIRT2079755	hsa-miR-330-5p	CLIP-seq
MIRT2079756	hsa-miR-3682-5p	CLIP-seq
MIRT2079757	hsa-miR-4262	CLIP-seq
MIRT2079758	hsa-miR-4283	CLIP-seq
MIRT2079759	hsa-miR-4489	CLIP-seq
MIRT2079760	hsa-miR-4656	CLIP-seq
MIRT2079761	hsa-miR-4667-5p	CLIP-seq
MIRT2079762	hsa-miR-4700-5p	CLIP-seq
MIRT2079763	hsa-miR-4709-5p	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT2079765	hsa-miR-486-5p	CLIP-seq
MIRT2079766	hsa-miR-637	CLIP-seq
MIRT1271161	hsa-miR-1207-5p	CLIP-seq
MIRT1271172	hsa-miR-3616-3p	CLIP-seq
MIRT2306078	hsa-miR-370	CLIP-seq
MIRT1271175	hsa-miR-4257	CLIP-seq
MIRT1271179	hsa-miR-4268	CLIP-seq
MIRT1271180	hsa-miR-4270	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271184	hsa-miR-4436b-3p	CLIP-seq
MIRT1271185	hsa-miR-4441	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT1271196	hsa-miR-4763-3p	CLIP-seq
MIRT2306079	hsa-miR-4763-5p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT2306080	hsa-miR-550a	CLIP-seq
MIRT2306081	hsa-miR-764	CLIP-seq
MIRT2393157	hsa-miR-1261	CLIP-seq
MIRT2393158	hsa-miR-3165	CLIP-seq
MIRT2393159	hsa-miR-4447	CLIP-seq
MIRT2393160	hsa-miR-4472	CLIP-seq
MIRT2393161	hsa-miR-4651	CLIP-seq
MIRT2079763	hsa-miR-4709-5p	CLIP-seq
MIRT2393162	hsa-miR-608	CLIP-seq
MIRT1271160	hsa-miR-1182	CLIP-seq
MIRT2457368	hsa-miR-3132	CLIP-seq
MIRT2457369	hsa-miR-4451	CLIP-seq
MIRT1271187	hsa-miR-4527	CLIP-seq
MIRT2457370	hsa-miR-4731-5p	CLIP-seq
MIRT1271166	hsa-miR-1972	CLIP-seq
MIRT1271169	hsa-miR-3123	CLIP-seq
MIRT1271174	hsa-miR-3925-5p	CLIP-seq
MIRT1271183	hsa-miR-4426	CLIP-seq
MIRT1271188	hsa-miR-4647	CLIP-seq
MIRT1271189	hsa-miR-4662b	CLIP-seq
MIRT1271191	hsa-miR-4690-5p	CLIP-seq
MIRT1271192	hsa-miR-4712-5p	CLIP-seq
MIRT2079764	hsa-miR-4715-3p	CLIP-seq
MIRT1271198	hsa-miR-515-5p	CLIP-seq
MIRT1271200	hsa-miR-770-5p	CLIP-seq
MIRT1271201	hsa-miR-873	CLIP-seq
MIRT1271202	hsa-miR-936	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	18411309
GO:0000922	Component	Spindle pole	IEA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0001578	Process	Microtubule bundle formation	ISS	12427559
GO:0005515	Function	Protein binding	IPI	18411309, 26820536, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	12427559
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS	12427559
GO:0005829	Component	Cytosol	IDA	18411309
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	18411309
GO:0007080	Process	Mitotic metaphase chromosome alignment	IBA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IDA	18411309
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS	12427559
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0015630	Component	Microtubule cytoskeleton	ISS	12427559
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS	12427559
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	ISS	12427559
GO:0031116	Process	Positive regulation of microtubule polymerization	IEA
GO:0031116	Process	Positive regulation of microtubule polymerization	ISS	12427559
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS	12427559
GO:0051301	Process	Cell division	IEA
GO:0060236	Process	Regulation of mitotic spindle organization	IDA	18411309

MIM	HGNC	e!Ensembl
613126	24472	ENSG00000134222

Q6PGN9

Protein name

Proline/serine-rich coiled-coil protein 1

Protein function

Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Incr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15259	GTSE1_N	8 → 118	G-2 and S-phase expressed 1	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues, with highest expression in the adult brain and fetal thymus. Not detected in adult skeletal muscle. {ECO:0000269|PubMed:12427559}.

Sequence

MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQ
GVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLK
DSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNL
FPASKSPASSPLTRSTPPVRGRAGPSGRAAASEETRAAKLRVSGSGEFVGLTLKFLHPSP
PGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPG
RGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNLQPPRKVAVPG
PTR

Sequence length

363

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	23535823, 37893562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24674750, 29378206, 31838625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22380622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24674750, 29378206, 31838625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25969834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	32238911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26070530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	24725463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22065898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10618717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18979498, 24725463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	19951432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	19951432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26464717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18649068, 24674750, 29378206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	17634449, 19164808, 22380622, 23535823, 24674750, 25528061, 26464717, 32858814, 34447459	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	18649068, 24674750, 26464717, 29378206, 30902787		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	34447459	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Autosomal Dominant 1	Coronary artery disease	Pubtator	22216278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18979498, 19955471, 22152955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18649068, 22152955, 24674750, 29378206		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	37582372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facioscapulohumeral muscular dystrophy 1a	Facioscapulohumeral muscular dystrophy	Pubtator	22380622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26464717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26214778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20839009, 21463265	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	25738804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	29356453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24709098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26214778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26214778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	29356453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22380622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSRC1 (proline and serine rich coiled-coil 1)