Gene Gene information from NCBI Gene database.
Entrez ID 84717
Gene name HDGF like 2
Gene symbol HDGFL2
Synonyms (NCBI Gene)
HDGF-2HDGF2HDGFRP2HRP-2HRP2
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a member of the hepatoma-derived growth factor (HDGF) family. The protein includes an N-terminal PWWP domain that binds to methyl-lysine-containing histones, with specific binding of this protein to tri-methylated lysines 36 and 79 of hi
miRNA miRNA information provided by mirtarbase database.
17
miRTarBase ID miRNA Experiments Reference
MIRT551602 hsa-miR-548ac PAR-CLIP 21572407
MIRT551601 hsa-miR-548bb-3p PAR-CLIP 21572407
MIRT551600 hsa-miR-548d-3p PAR-CLIP 21572407
MIRT551599 hsa-miR-548h-3p PAR-CLIP 21572407
MIRT551598 hsa-miR-548z PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21044950, 25689719, 26721387, 32459350
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 26721387
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617884 14680 ENSG00000167674
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z4V5
Protein name Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2)
Protein function Acts as an epigenetic regulator of myogenesis in cooperation with DPF3a (isoform 2 of DPF3/BAF45C) (PubMed:32459350). Associates with the BAF complex via its interaction with DPF3a and HDGFL2-DPF3a activate myogenic genes by increasing chromatin
PDB 3EAE , 3QBY , 3QJ6 , 6T3I , 7HG0 , 7HG1 , 7HG2 , 7HG3 , 7HG4 , 7HG5 , 7HG6 , 7HG7 , 7HG8 , 7HG9 , 7HGA , 7HGB , 7HGC , 7HGD , 7HGE , 7HGF , 7HGG , 7HGH , 7HGI , 7HGJ , 7HGK , 7HGL , 7HGM , 7HGN , 7HGO , 7HGP , 7HGQ , 7HGR , 7HGS , 7HGT , 7HGU , 7HGV , 7HGW , 7HGX , 7HGY , 7HGZ , 7HH0 , 7HH1 , 7HH2 , 7HH3 , 7HH4 , 7HH5 , 7HH6 , 7HH7 , 7HH8 , 7HH9 , 7HHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00855 PWWP 5 89 PWWP domain Domain
PF11467 LEDGF 472 573 Lens epithelium-derived growth factor (LEDGF) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is found in heart, skeletal muscle, ovary and testis. Overexpression is frequently observed in hepatocellular carcinoma samples. {ECO:0000269|PubMed:25689719}.
Sequence
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFP
YDKCKDKYGKPNKRKGFNEGLWEIQNNPH
ASYSAPPPVSSSDSEAPEANPADGSDADEDD
EDRGVMAVTAVTATAASDRMESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQA
SVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPRRGPLGGRKKKKAPSASDSDSKADS
DGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPLPKPRGRKPKPERPPSS
SSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERADRG
EAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHS
EIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAA
EVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEE
KLAGEELAGEEAPQEKAEDKPSTDLSA
PVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERA
RGDSEALDEES
Sequence length 671
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
17
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colorectal cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 29763915 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia GWASCAT_DG 27903959
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 25689719
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma Pubtator 35166240 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 25689719
★☆☆☆☆
Found in Text Mining only
Retinal Diseases Retinal Diseases BEFREE 28948179
★☆☆☆☆
Found in Text Mining only