Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8470
Gene name	Sorbin and SH3 domain containing 2
Gene symbol	SORBS2
Synonyms (NCBI Gene)	ARGBP2PRO0618
Chromosome	4
Chromosome location	4q35.1
Summary	Arg and c-Abl represent the mammalian members of the Abelson family of non-receptor protein-tyrosine kinases. They interact with the Arg/Abl binding proteins via the SH3 domains present in the carboxy end of the latter group of proteins. This gene encodes

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016899	hsa-miR-335-5p	Microarray	18185580
MIRT036452	hsa-miR-1226-3p	CLASH	23622248
MIRT664560	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT664559	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT664558	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT664560	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT664559	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT664558	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT626613	hsa-miR-3690	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT622153	hsa-miR-4254	HITS-CLIP	23824327
MIRT622152	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622151	hsa-miR-139-3p	HITS-CLIP	23824327
MIRT622150	hsa-miR-3671	HITS-CLIP	23824327
MIRT622149	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT622148	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT622147	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT622146	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1379507	hsa-miR-297	CLIP-seq
MIRT1379508	hsa-miR-3944-5p	CLIP-seq
MIRT1379509	hsa-miR-4470	CLIP-seq
MIRT1379510	hsa-miR-455-5p	CLIP-seq
MIRT1379511	hsa-miR-4742-5p	CLIP-seq
MIRT1379512	hsa-miR-567	CLIP-seq
MIRT1379513	hsa-miR-1273e	CLIP-seq
MIRT1379514	hsa-miR-3121-5p	CLIP-seq
MIRT2336412	hsa-miR-548p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	9211900
GO:0005515	Function	Protein binding	IPI	15161933, 15778465, 16125169, 16189514, 16374509, 18985028, 21988832, 25416956, 25910212, 32296183, 36931259
GO:0005634	Component	Nucleus	NAS	9211900
GO:0005634	Component	Nucleus	TAS	9211900
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007219	Process	Notch signaling pathway	IBA
GO:0008093	Function	Cytoskeletal anchor activity	TAS	9211900
GO:0008307	Function	Structural constituent of muscle	TAS	9211900
GO:0015629	Component	Actin cytoskeleton	TAS	9211900
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030018	Component	Z disc	NAS	9211900
GO:0030027	Component	Lamellipodium	IEA
GO:0030425	Component	Dendrite	IBA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0045202	Component	Synapse	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	ISS
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
616349	24098	ENSG00000154556

O94875

Protein name

Sorbin and SH3 domain-containing protein 2 (Arg-binding protein 2) (ArgBP2) (Arg/Abl-interacting protein 2) (Sorbin)

Protein function

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1. May play a role in th

PDB

5VEI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02208	Sorb	70 → 114	Sorbin homologous domain	Family
PF00018	SH3_1	869 → 914	SH3 domain	Domain
PF00018	SH3_1	944 → 991	SH3 domain	Domain
PF14604	SH3_9	1048 → 1098	Variant SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in heart. In cardiac muscle cells, located in the Z-disks of sarcomere. Also found, but to a lower extent, in small and large intestine, pancreas, thymus, colon, spleen, prostate, testis, brain, ovary and epithelia

Sequence

MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEE
EKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNT
PYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPL
RPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPASLYQSSIDRSL
ERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSP
SSPSRAKGGDDSKICPSLCSYSGLNGNPSSELDYCSTYRQHLDVPRDSPRAISFKNGWQM
ARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPM
AWGSPYVPEVRSNGRSRIRHRSARNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQY
ESEQQHKDLLRAWSQCSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDDMLSPVTLEPPQ
NGLCPKRRFSIEYLLEEENQSGPPARGRRGCQSNALVPIHIEVTSDEQPRAHVEFSDSDQ
DGVVSDHSDYIHLEGSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHHRHLISSCKGR
CPASYTRFTTMLKHERARHENTEEPRRQEMDPGLSKLAFLVSPVPFRRKKNSAPKKQTEK
AKCKASVFEALDSALKDICDQIKAEKKRGSLPDNSILHRLISELLPDVPERNSSLRALRR
SPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPR
SYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNW
YEGEHHGRVGIFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLR
KGDRVILLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDR
IHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFV
GTSRRTKFFGTFPGNYVKRL

Sequence length

1100

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	18559503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35590369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28798985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33934539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33311452	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29548303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35794104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35590369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASDB_DG	22763110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35794104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24551190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facioscapulohumeral muscular dystrophy 1a	Facioscapulohumeral muscular dystrophy	Pubtator	26359233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38177123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28336264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35590369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	35590369	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31365778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29548303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19631450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29548303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	19888305, 26359233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24342996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	36036911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36597889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21602178, 27311882, 29548303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28123940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34922489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29548303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19631450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18559503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24551190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34707683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29339121, 33880576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34315402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24165198	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

SORBS2 (sorbin and SH3 domain containing 2)