Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84675
Gene name	Tripartite motif containing 55
Gene symbol	TRIM55
Synonyms (NCBI Gene)	MURF-2RNF29muRF2
Chromosome	8
Chromosome location	8q13.1
Summary	The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transien

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments
MIRT1455163	hsa-miR-1245b-5p	CLIP-seq
MIRT1455164	hsa-miR-1299	CLIP-seq
MIRT1455165	hsa-miR-3142	CLIP-seq
MIRT1455166	hsa-miR-3160-5p	CLIP-seq
MIRT1455167	hsa-miR-3619-3p	CLIP-seq
MIRT1455168	hsa-miR-378	CLIP-seq
MIRT1455169	hsa-miR-378b	CLIP-seq
MIRT1455170	hsa-miR-378c	CLIP-seq
MIRT1455171	hsa-miR-378d	CLIP-seq
MIRT1455172	hsa-miR-378e	CLIP-seq
MIRT1455173	hsa-miR-378f	CLIP-seq
MIRT1455174	hsa-miR-378h	CLIP-seq
MIRT1455175	hsa-miR-378i	CLIP-seq
MIRT1455176	hsa-miR-422a	CLIP-seq
MIRT1455177	hsa-miR-4638-3p	CLIP-seq
MIRT1455178	hsa-miR-4650-5p	CLIP-seq
MIRT1455179	hsa-miR-4776-5p	CLIP-seq
MIRT1455180	hsa-miR-4782-5p	CLIP-seq
MIRT1455181	hsa-miR-516b	CLIP-seq
MIRT1455182	hsa-miR-591	CLIP-seq
MIRT2357299	hsa-miR-103b	CLIP-seq
MIRT2357300	hsa-miR-1208	CLIP-seq
MIRT1455163	hsa-miR-1245b-5p	CLIP-seq
MIRT1455164	hsa-miR-1299	CLIP-seq
MIRT2357301	hsa-miR-133a	CLIP-seq
MIRT2357302	hsa-miR-133b	CLIP-seq
MIRT1455165	hsa-miR-3142	CLIP-seq
MIRT1455166	hsa-miR-3160-5p	CLIP-seq
MIRT1455167	hsa-miR-3619-3p	CLIP-seq
MIRT1455168	hsa-miR-378	CLIP-seq
MIRT1455169	hsa-miR-378b	CLIP-seq
MIRT1455170	hsa-miR-378c	CLIP-seq
MIRT1455171	hsa-miR-378d	CLIP-seq
MIRT1455172	hsa-miR-378e	CLIP-seq
MIRT1455173	hsa-miR-378f	CLIP-seq
MIRT1455174	hsa-miR-378h	CLIP-seq
MIRT1455175	hsa-miR-378i	CLIP-seq
MIRT1455176	hsa-miR-422a	CLIP-seq
MIRT2357303	hsa-miR-4311	CLIP-seq
MIRT2357304	hsa-miR-4420	CLIP-seq
MIRT1455177	hsa-miR-4638-3p	CLIP-seq
MIRT1455179	hsa-miR-4776-5p	CLIP-seq
MIRT1455180	hsa-miR-4782-5p	CLIP-seq
MIRT2357305	hsa-miR-4793-3p	CLIP-seq
MIRT1455181	hsa-miR-516b	CLIP-seq
MIRT1455182	hsa-miR-591	CLIP-seq
MIRT2357306	hsa-miR-9	CLIP-seq
MIRT2357300	hsa-miR-1208	CLIP-seq
MIRT2357304	hsa-miR-4420	CLIP-seq
MIRT2357305	hsa-miR-4793-3p	CLIP-seq
MIRT2462352	hsa-miR-5096	CLIP-seq
MIRT2357300	hsa-miR-1208	CLIP-seq
MIRT2357304	hsa-miR-4420	CLIP-seq
MIRT2357305	hsa-miR-4793-3p	CLIP-seq
MIRT2462352	hsa-miR-5096	CLIP-seq
MIRT2357300	hsa-miR-1208	CLIP-seq
MIRT2357304	hsa-miR-4420	CLIP-seq
MIRT2357305	hsa-miR-4793-3p	CLIP-seq
MIRT2462352	hsa-miR-5096	CLIP-seq
MIRT2357300	hsa-miR-1208	CLIP-seq
MIRT2357304	hsa-miR-4420	CLIP-seq
MIRT2357305	hsa-miR-4793-3p	CLIP-seq
MIRT2462352	hsa-miR-5096	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0005515	Function	Protein binding	IPI	22493164, 25127057, 31391242, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	37816088
GO:0005737	Component	Cytoplasm	IEA
GO:0005874	Component	Microtubule	NAS	11243782
GO:0007165	Process	Signal transduction	NAS	11243782
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	37816088
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	37816088
GO:0042802	Function	Identical protein binding	IPI	22493164
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050904	Process	Diapedesis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	37816088
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	37816088
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	37816088
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	37816088
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	37816088
GO:1905517	Process	Macrophage migration	IEA

MIM	HGNC	e!Ensembl
606469	14215	ENSG00000147573

Q9BYV6

Protein name

Tripartite motif-containing protein 55 (EC 2.3.2.27) (Muscle-specific RING finger protein 2) (MuRF-2) (MuRF2) (RING finger protein 29)

Protein function

E3 ubiquitin ligase that plays an important role in regulating cardiac development and contractility, muscle growth, metabolism, and fiber-type differentiation. Acts as a critical factor that regulates cardiomyocyte size during development in co

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13445	zf-RING_UBOX	26 → 79	RING-type zinc-finger	Domain
PF00643	zf-B_box	119 → 167	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in muscle. Low-level expression in liver. {ECO:0000269|PubMed:11243782}.

Sequence

MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNP
YLPTRGGTTMASGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSD
QPMCEEHEEERINIYCLNCEVPTCSLCKVFGAHKDCQVAPLTHVFQRQKSELSDGIAILV
GSNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEK
LEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQNAKTLLKKISEASKAFQMEKI
EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVGGEAVEVEEVE
NVQTEFPGEDENPEKASELSQVELQAAPGALPVSSPEPPPALPPAADAPVTQGEVVPTGS
EQTTESETPVPAAAETADPLFYPSWYKGQTRKATTNPPCTPGSEGLGQIGPPGSEDSNVR
KAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSF
SWLNSLNE

Sequence length

548

Interactions

View interactions

	KEGG
	Cytoskeleton in muscle cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIM55-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30685767, 34974792	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34887858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	24865491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	31140761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37212463	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31140761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	36737649	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24865491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	24865491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30685767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34974792	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36419120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM55 (tripartite motif containing 55)