Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84647
Gene name	Phospholipase A2 group XIIB
Gene symbol	PLA2G12B
Synonyms (NCBI Gene)	FKSG71GXIIBGXIIIsPLA2PLA2G13sPLA2-GXIIB
Chromosome	10
Chromosome location	10q22.1
Summary	The protein encoded by this gene belongs to the phospholipase A2 (PLA2) group of enzymes, which function in glycolipid hydrolysis with the release of free fatty acids and lysophospholipids. This family member has altered phospholipid-binding properties an

Show/Hide all (4)

miRTarBase ID	miRNA	Experiments
MIRT2070173	hsa-miR-4530	CLIP-seq
MIRT2070174	hsa-miR-4640-5p	CLIP-seq
MIRT2070175	hsa-miR-4726-5p	CLIP-seq
MIRT2070176	hsa-miR-922	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050482	Process	Arachidonate secretion	IEA
GO:0070328	Process	Triglyceride homeostasis	IBA

MIM	HGNC	e!Ensembl
611653	18555	ENSG00000138308

Q9BX93

Protein name

Group XIIB secretory phospholipase A2-like protein (Group XIII secretory phospholipase A2-like protein) (GXIII sPLA2-like) (sPLA2-GXIIB) (GXIIB)

Protein function

Not known; does not seem to have catalytic activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06951	PLA2G12	11 → 195	Group XII secretory phospholipase A2 precursor (PLA2G12)	Domain

Tissue specificity

TISSUE SPECIFICITY: Strong expression in liver, small intestine and kidney. {ECO:0000269|PubMed:14516201}.

Sequence

MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL

Sequence length

195

Interactions

View interactions

	KEGG
	Glycerophospholipid metabolism Ether lipid metabolism Arachidonic acid metabolism Linoleic acid metabolism alpha-Linolenic acid metabolism Metabolic pathways Ras signaling pathway Vascular smooth muscle contraction Pancreatic secretion Fat digestion and absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	31160422		★★★★★ ★☆☆☆☆ Found in Text Mining only

PLA2G12B (phospholipase A2 group XIIB)