Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84640
Gene name	Ubiquitin specific peptidase 38
Gene symbol	USP38
Synonyms (NCBI Gene)	HP43.8KD
Chromosome	4
Chromosome location	4q31.21

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023119	hsa-miR-124-3p	Microarray	18668037
MIRT050808	hsa-miR-17-5p	CLASH	23622248
MIRT048041	hsa-miR-148a-3p	CLASH	23622248
MIRT553021	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT553020	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT553019	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT553018	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT553017	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT553016	hsa-miR-4500	PAR-CLIP	21572407
MIRT553015	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT553014	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT553013	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT553012	hsa-miR-4458	PAR-CLIP	21572407
MIRT553011	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT553010	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT553009	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT553008	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT553007	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT553006	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT553005	hsa-miR-376a-2-5p	PAR-CLIP	21572407
MIRT553004	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT553003	hsa-miR-3658	PAR-CLIP	21572407
MIRT553002	hsa-miR-587	PAR-CLIP	21572407
MIRT553001	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT553021	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT553020	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT553019	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT553018	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT553017	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT553016	hsa-miR-4500	PAR-CLIP	21572407
MIRT553015	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT553014	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT553013	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT553012	hsa-miR-4458	PAR-CLIP	21572407
MIRT553011	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT553010	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT553009	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT553008	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT553007	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT553006	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT553005	hsa-miR-376a-2-5p	PAR-CLIP	21572407
MIRT553004	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT553003	hsa-miR-3658	PAR-CLIP	21572407
MIRT553002	hsa-miR-587	PAR-CLIP	21572407
MIRT553001	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT1479555	hsa-miR-101	CLIP-seq
MIRT1479556	hsa-miR-124	CLIP-seq
MIRT1479557	hsa-miR-1248	CLIP-seq
MIRT1479558	hsa-miR-1278	CLIP-seq
MIRT1479559	hsa-miR-129-5p	CLIP-seq
MIRT1479560	hsa-miR-1303	CLIP-seq
MIRT1479561	hsa-miR-132	CLIP-seq
MIRT1479562	hsa-miR-1343	CLIP-seq
MIRT1479563	hsa-miR-144	CLIP-seq
MIRT1479564	hsa-miR-148a	CLIP-seq
MIRT1479565	hsa-miR-148b	CLIP-seq
MIRT1479566	hsa-miR-152	CLIP-seq
MIRT1479567	hsa-miR-1825	CLIP-seq
MIRT1479568	hsa-miR-212	CLIP-seq
MIRT1479569	hsa-miR-216a	CLIP-seq
MIRT1479570	hsa-miR-216b	CLIP-seq
MIRT1479571	hsa-miR-217	CLIP-seq
MIRT1479572	hsa-miR-2276	CLIP-seq
MIRT1479573	hsa-miR-3136-5p	CLIP-seq
MIRT1479574	hsa-miR-3148	CLIP-seq
MIRT1479575	hsa-miR-3153	CLIP-seq
MIRT1479576	hsa-miR-3660	CLIP-seq
MIRT1479577	hsa-miR-3675-3p	CLIP-seq
MIRT1479578	hsa-miR-374a	CLIP-seq
MIRT1479579	hsa-miR-374b	CLIP-seq
MIRT1479580	hsa-miR-375	CLIP-seq
MIRT1479581	hsa-miR-3978	CLIP-seq
MIRT1479582	hsa-miR-4261	CLIP-seq
MIRT1479583	hsa-miR-4299	CLIP-seq
MIRT1479584	hsa-miR-4418	CLIP-seq
MIRT1479585	hsa-miR-4439	CLIP-seq
MIRT1479586	hsa-miR-4452	CLIP-seq
MIRT1479587	hsa-miR-4453	CLIP-seq
MIRT1479588	hsa-miR-4513	CLIP-seq
MIRT1479589	hsa-miR-4526	CLIP-seq
MIRT1479590	hsa-miR-4538	CLIP-seq
MIRT1479591	hsa-miR-4668-5p	CLIP-seq
MIRT1479592	hsa-miR-4708-3p	CLIP-seq
MIRT1479593	hsa-miR-494	CLIP-seq
MIRT1479594	hsa-miR-495	CLIP-seq
MIRT1479595	hsa-miR-506	CLIP-seq
MIRT1479596	hsa-miR-509-3-5p	CLIP-seq
MIRT1479597	hsa-miR-509-3p	CLIP-seq
MIRT1479598	hsa-miR-509-5p	CLIP-seq
MIRT1479599	hsa-miR-548a-3p	CLIP-seq
MIRT1479600	hsa-miR-548e	CLIP-seq
MIRT1479601	hsa-miR-548f	CLIP-seq
MIRT1479602	hsa-miR-577	CLIP-seq
MIRT1479603	hsa-miR-582-5p	CLIP-seq
MIRT2144362	hsa-miR-1251	CLIP-seq
MIRT2144363	hsa-miR-1301	CLIP-seq
MIRT1479561	hsa-miR-132	CLIP-seq
MIRT1479568	hsa-miR-212	CLIP-seq
MIRT1479572	hsa-miR-2276	CLIP-seq
MIRT2144364	hsa-miR-3143	CLIP-seq
MIRT2144365	hsa-miR-337-3p	CLIP-seq
MIRT2144366	hsa-miR-3646	CLIP-seq
MIRT2144367	hsa-miR-3647-3p	CLIP-seq
MIRT2144368	hsa-miR-3662	CLIP-seq
MIRT2144369	hsa-miR-3682-5p	CLIP-seq
MIRT2144370	hsa-miR-4263	CLIP-seq
MIRT2144371	hsa-miR-4282	CLIP-seq
MIRT2144372	hsa-miR-4424	CLIP-seq
MIRT1479586	hsa-miR-4452	CLIP-seq
MIRT2144373	hsa-miR-450b-5p	CLIP-seq
MIRT2144374	hsa-miR-5047	CLIP-seq
MIRT2144375	hsa-miR-507	CLIP-seq
MIRT2144376	hsa-miR-543	CLIP-seq
MIRT2144377	hsa-miR-548c-3p	CLIP-seq
MIRT2144378	hsa-miR-557	CLIP-seq
MIRT2364577	hsa-let-7a	CLIP-seq
MIRT2364578	hsa-let-7b	CLIP-seq
MIRT2364579	hsa-let-7c	CLIP-seq
MIRT2364580	hsa-let-7d	CLIP-seq
MIRT2364581	hsa-let-7e	CLIP-seq
MIRT2364582	hsa-let-7f	CLIP-seq
MIRT2364583	hsa-let-7g	CLIP-seq
MIRT2364584	hsa-let-7i	CLIP-seq
MIRT1479561	hsa-miR-132	CLIP-seq
MIRT1479564	hsa-miR-148a	CLIP-seq
MIRT1479565	hsa-miR-148b	CLIP-seq
MIRT1479566	hsa-miR-152	CLIP-seq
MIRT1479567	hsa-miR-1825	CLIP-seq
MIRT1479568	hsa-miR-212	CLIP-seq
MIRT2144365	hsa-miR-337-3p	CLIP-seq
MIRT2364585	hsa-miR-3912	CLIP-seq
MIRT2364586	hsa-miR-3927	CLIP-seq
MIRT2364587	hsa-miR-98	CLIP-seq
MIRT2441614	hsa-miR-128	CLIP-seq
MIRT2441615	hsa-miR-3117-5p	CLIP-seq
MIRT2441616	hsa-miR-4728-3p	CLIP-seq
MIRT2463045	hsa-miR-1238	CLIP-seq
MIRT2144370	hsa-miR-4263	CLIP-seq
MIRT2144372	hsa-miR-4424	CLIP-seq
MIRT2463046	hsa-miR-4427	CLIP-seq
MIRT1479586	hsa-miR-4452	CLIP-seq
MIRT2463047	hsa-miR-4659a-3p	CLIP-seq
MIRT2463048	hsa-miR-4659b-3p	CLIP-seq
MIRT2463049	hsa-miR-4680-3p	CLIP-seq
MIRT2658425	hsa-miR-142-5p	CLIP-seq
MIRT2658426	hsa-miR-186	CLIP-seq
MIRT2658427	hsa-miR-3133	CLIP-seq
MIRT2658428	hsa-miR-340	CLIP-seq
MIRT1479599	hsa-miR-548a-3p	CLIP-seq
MIRT2658429	hsa-miR-548ae	CLIP-seq
MIRT2658430	hsa-miR-548aj	CLIP-seq
MIRT2658431	hsa-miR-548am	CLIP-seq
MIRT1479600	hsa-miR-548e	CLIP-seq
MIRT1479601	hsa-miR-548f	CLIP-seq
MIRT2658432	hsa-miR-548k	CLIP-seq
MIRT2658433	hsa-miR-548n	CLIP-seq
MIRT2658434	hsa-miR-548x	CLIP-seq
MIRT2658425	hsa-miR-142-5p	CLIP-seq
MIRT2658426	hsa-miR-186	CLIP-seq
MIRT2658427	hsa-miR-3133	CLIP-seq
MIRT2658428	hsa-miR-340	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245, 27692986
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	34102342
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	27692986
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	34102342
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	27692986
GO:0045824	Process	Negative regulation of innate immune response	IDA	27692986
GO:0045824	Process	Negative regulation of innate immune response	IDA	27692986
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	27692986
GO:0140374	Process	Antiviral innate immune response	IDA	14703513
GO:1990168	Process	Protein K33-linked deubiquitination	IDA	27692986

MIM	HGNC	e!Ensembl
618322	20067	ENSG00000170185

Q8NB14

Protein name

Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.4.19.12) (Deubiquitinating enzyme 38) (HP43.8KD) (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38)

Protein function

Deubiquitinating enzyme that plays a role in various cellular processes, including DNA repair, cell cycle regulation, and immune response (PubMed:22689415, PubMed:30497519, PubMed:31874856, PubMed:35238669). Plays a role in the inhibition of typ

PDB

4RXX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	445 → 946	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle. Expressed in adrenal gland. {ECO:0000269|PubMed:11572484, ECO:0000269|PubMed:14715245}.

Sequence

MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLHQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQERELREYVSQVTKVSNLLQNIWKAEPATLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVH
SFKNDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEE
KILKVQASHKPSEILECSETSLQEVASKAAVLTETPRTSDGEKTLIEKMFGGKLRTHIRC
LNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDPASSPSIQDGGLMQASVPGPSEEPVVY
NPTTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKILVNKDVPQKPGGETTPSVTD
LLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRITSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKLVPY
LLSSVVVHSGISSESGHYYSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVF
EQDLENKEMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQHSTNGLSGNNP
TSGLWINGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPP
GSCGPTGGGGGGGFNTVGRLVF

Sequence length

1042

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLARY RENAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
alpha Thalassemia	Alpha thalassemia	Pubtator	25805752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21804548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30224386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22961600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	31723061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36204976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35114776	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22961600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35238669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36288387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP38 (ubiquitin specific peptidase 38)