SUPT3H (SPT3 homolog, SAGA and STAGA complex component)

Gene

• Entrez ID: 8464
• Gene name: SPT3 homolog, SAGA and STAGA complex component
• Gene symbol: SUPT3H
• Synonyms (NCBI Gene): SPT3, SPT3L
• Chromosome: 6
• Chromosome location: 6p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029827	hsa-miR-26b-5p	Microarray	19088304
MIRT046510	hsa-miR-15b-5p	CLASH	23622248
MIRT1403516	hsa-miR-3160-3p	CLIP-seq
MIRT1403517	hsa-miR-3173-3p	CLIP-seq
MIRT1403518	hsa-miR-3616-3p	CLIP-seq
MIRT1403519	hsa-miR-3646	CLIP-seq
MIRT1403520	hsa-miR-3928	CLIP-seq
MIRT1403521	hsa-miR-4275	CLIP-seq
MIRT1403522	hsa-miR-4436b-3p	CLIP-seq
MIRT1403523	hsa-miR-4443	CLIP-seq
MIRT1403524	hsa-miR-4487	CLIP-seq
MIRT1403525	hsa-miR-4501	CLIP-seq
MIRT1403526	hsa-miR-4721	CLIP-seq
MIRT1403527	hsa-miR-4779	CLIP-seq
MIRT1403528	hsa-miR-548ag	CLIP-seq
MIRT1403529	hsa-miR-548ai	CLIP-seq
MIRT1403530	hsa-miR-558	CLIP-seq
MIRT1403531	hsa-miR-765	CLIP-seq
MIRT1403532	hsa-miR-873	CLIP-seq
MIRT2342956	hsa-miR-125a-3p	CLIP-seq
MIRT2342957	hsa-miR-1292	CLIP-seq
MIRT2342958	hsa-miR-1297	CLIP-seq
MIRT2342959	hsa-miR-224	CLIP-seq
MIRT2342960	hsa-miR-26a	CLIP-seq
MIRT2342961	hsa-miR-26b	CLIP-seq
MIRT2342962	hsa-miR-3659	CLIP-seq
MIRT2342963	hsa-miR-4465	CLIP-seq
MIRT2342964	hsa-miR-4471	CLIP-seq
MIRT2342965	hsa-miR-488	CLIP-seq
MIRT2342966	hsa-miR-498	CLIP-seq
MIRT2342967	hsa-miR-552	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000124	Component	SAGA complex	IDA	11564863
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	11564863
GO:0005634	Component	Nucleus	IDA	9726987, 11564863
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9787080
GO:0005654	Component	Nucleoplasm	IDA
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9787080, 17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	9787080
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9787080
GO:0033276	Component	Transcription factor TFTC complex	IDA	10373431
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9787080, 18206972
GO:0046982	Function	Protein heterodimerization activity	IEA

Other IDs

• MIM: 602947
• HGNC: 11466
• e!Ensembl: ENSG00000196284

Protein

• UniProt ID: O75486
• Protein name: Transcription initiation protein SPT3 homolog (SPT3-like protein)
• Protein function: Probable transcriptional activator.
• PDB: 7KTR, 7KTS, 8H7G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02269	TFIID-18kDa	24 → 116	Transcription initiation factor IID, 18kD subunit	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
• Sequence:

  MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLI
  NLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLL
  EDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSA
  QYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVR
  QDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
  SPFTNAYRRNGMAFLAC

• Sequence length: 317

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEIDOCRANIAL DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE IDIOPATHIC SKELETAL HYPEROSTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FACIAL NERVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	35589867	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27701424	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASDB_DG	22763110		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	22763110		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30010910		★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	24055526	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35550147	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19955365		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30010910	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	36089590	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30374069, 30664745		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	19955365		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27531877		★☆☆☆☆ Found in Text Mining only