Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84639
Gene name	Interleukin 1 family member 10
Gene symbol	IL1F10
Synonyms (NCBI Gene)	FIL1-thetaFKSG75IL-1HY2IL-38IL1-thetaIL1HY2
Chromosome	2
Chromosome location	2q14.1
Summary	The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 fam

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	23592263
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT487500	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT487498	hsa-miR-4784	PAR-CLIP	23592263
MIRT487497	hsa-miR-3119	PAR-CLIP	23592263
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	23592263
MIRT487495	hsa-miR-623	PAR-CLIP	23592263
MIRT487494	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT487493	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	20371350
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT487500	hsa-miR-212-5p	PAR-CLIP	20371350
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT487498	hsa-miR-4784	PAR-CLIP	20371350
MIRT487497	hsa-miR-3119	PAR-CLIP	20371350
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT487495	hsa-miR-623	PAR-CLIP	20371350
MIRT487494	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT487493	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	20371350
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT487502	hsa-miR-4780	PAR-CLIP	23592263
MIRT487501	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT487500	hsa-miR-212-5p	PAR-CLIP	23592263
MIRT487499	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT487498	hsa-miR-4784	PAR-CLIP	23592263
MIRT487497	hsa-miR-3119	PAR-CLIP	23592263
MIRT487496	hsa-miR-642b-5p	PAR-CLIP	23592263
MIRT487495	hsa-miR-623	PAR-CLIP	23592263
MIRT487494	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT487493	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT487492	hsa-miR-3692-3p	PAR-CLIP	23592263
MIRT487491	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT487489	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT1064205	hsa-miR-23a	CLIP-seq
MIRT1064206	hsa-miR-23b	CLIP-seq
MIRT1064207	hsa-miR-23c	CLIP-seq
MIRT1064208	hsa-miR-34b	CLIP-seq
MIRT1064209	hsa-miR-450b-5p	CLIP-seq
MIRT1064210	hsa-miR-518a-5p	CLIP-seq
MIRT1064211	hsa-miR-527	CLIP-seq
MIRT1064212	hsa-miR-9	CLIP-seq
MIRT2247571	hsa-miR-1275	CLIP-seq
MIRT2247572	hsa-miR-4260	CLIP-seq
MIRT2247573	hsa-miR-4457	CLIP-seq
MIRT2247574	hsa-miR-4488	CLIP-seq
MIRT2247575	hsa-miR-4665-5p	CLIP-seq
MIRT2247576	hsa-miR-4697-5p	CLIP-seq
MIRT2247577	hsa-miR-548ad	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
615296	15552	ENSG00000136697

Q8WWZ1

Protein name

Interleukin-1 family member 10 (IL-1F10) (Family of interleukin 1-theta) (FIL1 theta) (Interleukin-1 HY2) (IL-1HY2) (Interleukin-1 theta) (IL-1 theta) (Interleukin-38) (IL-38)

Protein function

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononu

PDB

5BOW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00340	IL1	32 → 148	Interleukin-1 / 18	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.

Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLG
IQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGW
FLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-38 signaling Interleukin-36 pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28727766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22312160, 29366546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30165364, 30902143, 31507607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26701127, 28288964, 29366546, 30871134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16918024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29366546, 30871134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27438823, 31645649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30165364, 30902143, 31507607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32601180	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26819499, 28727766, 34799942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28727766, 29247986, 29988385, 31387327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33125159	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35833307	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33125159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	27438823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26701127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30643810	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31786620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31786620	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	31244436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21889313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	27926540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27769564, 29554104, 30995480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	34428579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31387327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	39568029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	34799942, 36397279	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34799942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28975626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30165364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30643810, 30901679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30643810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27769564, 29554104, 30995480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27769564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30381361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30381361, 31507607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33125159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31746138		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	28727766, 31786620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30381361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30477747, 31507607		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	26701127, 27926540, 29366546, 30377293, 30871134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	35833307	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	30643810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28584235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20141484, 28288964, 30268016, 31387327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	36932980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29762676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25902739	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27769564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31572353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34799942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IL1F10 (interleukin 1 family member 10)