GPR174 (G protein-coupled receptor 174)

Gene

• Entrez ID: 84636
• Gene name: G protein-coupled receptor 174
• Gene symbol: GPR174
• Synonyms (NCBI Gene): FKSG79, GPCR17, LPS3, LYPSR3
• Chromosome: X
• Chromosome location: Xq21.1
• Summary: This gene encodes a protein belonging to the G protein-coupled receptor superfamily. These proteins are characterized by the presence of seven alpha-helical transmembrane domains, and they activate or interact with various endogenous or exogenous ligands,

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	36823105
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0016020	Component	Membrane	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	29457279
GO:0034451	Component	Centriolar satellite	IDA
GO:0043029	Process	T cell homeostasis	IEA
GO:0045125	Function	Bioactive lipid receptor activity	IEA

Other IDs

• MIM: 300903
• HGNC: 30245
• e!Ensembl: ENSG00000147138

Protein

• UniProt ID: Q9BXC1
• Protein name: Probable G-protein coupled receptor 174
• Protein function: G-protein-coupled receptor of lysophosphatidylserine (LysoPS) that plays different roles in immune response (PubMed:36823105). Plays a negative role in regulatory T-cell accumulation and homeostasis. Under inflammatory conditions where LysoPS pr
• PDB: 7XV3, 8IZB, 8KH5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	36 → 292	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN
  LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL
  MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA
  QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL
  ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR
  RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC

• Sequence length: 333

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GPR174-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25295623, 30850582		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23612905, 23667180, 24289805, 28568286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23667180, 28568286, 30616589, 32342657, 32727090, 35610583	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	32727090	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	32727090	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	28568286		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	28568286	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30850582, 31786099		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	32727090	Associate	★☆☆☆☆ Found in Text Mining only