Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8463
Gene name	TEA domain transcription factor 2
Gene symbol	TEAD2
Synonyms (NCBI Gene)	ETFTEAD-2TEF-4TEF4
Chromosome	19
Chromosome location	19q13.33

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017098	hsa-miR-335-5p	Microarray	18185580
MIRT042715	hsa-miR-346	CLASH	23622248
MIRT041334	hsa-miR-193b-3p	CLASH	23622248
MIRT1417506	hsa-miR-1245b-5p	CLIP-seq
MIRT1417507	hsa-miR-1252	CLIP-seq
MIRT1417508	hsa-miR-1255a	CLIP-seq
MIRT1417509	hsa-miR-1255b	CLIP-seq
MIRT1417510	hsa-miR-1294	CLIP-seq
MIRT1417511	hsa-miR-1295	CLIP-seq
MIRT1417512	hsa-miR-142-5p	CLIP-seq
MIRT1417513	hsa-miR-1537	CLIP-seq
MIRT1417514	hsa-miR-3142	CLIP-seq
MIRT1417515	hsa-miR-3667-5p	CLIP-seq
MIRT1417516	hsa-miR-3921	CLIP-seq
MIRT1417517	hsa-miR-3944-5p	CLIP-seq
MIRT1417518	hsa-miR-421	CLIP-seq
MIRT1417519	hsa-miR-4316	CLIP-seq
MIRT1417520	hsa-miR-4476	CLIP-seq
MIRT1417521	hsa-miR-4496	CLIP-seq
MIRT1417522	hsa-miR-4533	CLIP-seq
MIRT1417523	hsa-miR-4649-3p	CLIP-seq
MIRT1417524	hsa-miR-4653-5p	CLIP-seq
MIRT1417525	hsa-miR-4677-3p	CLIP-seq
MIRT1417526	hsa-miR-4757-5p	CLIP-seq
MIRT1417527	hsa-miR-495	CLIP-seq
MIRT1417528	hsa-miR-577	CLIP-seq
MIRT1417529	hsa-miR-603	CLIP-seq
MIRT2125356	hsa-miR-1238	CLIP-seq
MIRT1417508	hsa-miR-1255a	CLIP-seq
MIRT1417509	hsa-miR-1255b	CLIP-seq
MIRT2125357	hsa-miR-1275	CLIP-seq
MIRT1417512	hsa-miR-142-5p	CLIP-seq
MIRT2125358	hsa-miR-1910	CLIP-seq
MIRT2125359	hsa-miR-296-5p	CLIP-seq
MIRT1417515	hsa-miR-3667-5p	CLIP-seq
MIRT2125360	hsa-miR-3918	CLIP-seq
MIRT1417517	hsa-miR-3944-5p	CLIP-seq
MIRT1417518	hsa-miR-421	CLIP-seq
MIRT2125361	hsa-miR-4260	CLIP-seq
MIRT2125362	hsa-miR-4264	CLIP-seq
MIRT2125363	hsa-miR-4266	CLIP-seq
MIRT2125364	hsa-miR-4284	CLIP-seq
MIRT2125365	hsa-miR-4488	CLIP-seq
MIRT2125366	hsa-miR-4506	CLIP-seq
MIRT2125367	hsa-miR-455-3p	CLIP-seq
MIRT2125368	hsa-miR-4665-5p	CLIP-seq
MIRT2125369	hsa-miR-4697-5p	CLIP-seq
MIRT2125370	hsa-miR-4749-3p	CLIP-seq
MIRT2125371	hsa-miR-515-5p	CLIP-seq
MIRT1417528	hsa-miR-577	CLIP-seq
MIRT1417529	hsa-miR-603	CLIP-seq
MIRT1417508	hsa-miR-1255a	CLIP-seq
MIRT1417509	hsa-miR-1255b	CLIP-seq
MIRT1417510	hsa-miR-1294	CLIP-seq
MIRT2347570	hsa-miR-1324	CLIP-seq
MIRT2125358	hsa-miR-1910	CLIP-seq
MIRT2347571	hsa-miR-342-3p	CLIP-seq
MIRT2347572	hsa-miR-3942-3p	CLIP-seq
MIRT2347573	hsa-miR-412	CLIP-seq
MIRT1417518	hsa-miR-421	CLIP-seq
MIRT2125363	hsa-miR-4266	CLIP-seq
MIRT1417519	hsa-miR-4316	CLIP-seq
MIRT2125367	hsa-miR-455-3p	CLIP-seq
MIRT1417525	hsa-miR-4677-3p	CLIP-seq
MIRT2347574	hsa-miR-4695-3p	CLIP-seq
MIRT2347575	hsa-miR-513a-5p	CLIP-seq
MIRT2347576	hsa-miR-758	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IPI	20368466
GO:0001570	Process	Vasculogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	18579750, 19324877
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	20368466
GO:0003700	Function	DNA-binding transcription factor activity	NAS	8702974
GO:0005515	Function	Protein binding	IPI	18579750, 19324877, 20368466, 25416956, 25751139, 32296183, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8702974
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	8702974
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0030903	Process	Notochord development	IEA
GO:0035329	Process	Hippo signaling	IBA
GO:0035329	Process	Hippo signaling	IDA	18579750, 19324877
GO:0035329	Process	Hippo signaling	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20368466
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048339	Process	Paraxial mesoderm development	IEA
GO:0048368	Process	Lateral mesoderm development	IEA
GO:0048568	Process	Embryonic organ development	IBA
GO:0060485	Process	Mesenchyme development	IEA
GO:0065003	Process	Protein-containing complex assembly	IMP	20368466
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0097718	Function	Disordered domain specific binding	IMP	20368466
GO:0140552	Component	TEAD-YAP complex	IDA	20368466
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000736	Process	Regulation of stem cell differentiation	IEA

MIM	HGNC	e!Ensembl
601729	11715	ENSG00000074219

Q15562

Protein name

Transcriptional enhancer factor TEF-4 (TEA domain family member 2) (TEAD-2)

Protein function

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cas

PDB

3L15 , 5DQ8 , 5DQE , 5EMV , 5HGU , 6CDY , 6E5G , 6S60 , 6S64 , 6S66 , 6S69 , 6S6J , 6UYB , 6UYC , 6VAH , 7OYJ , 7T2J , 7T2K , 7T2L , 7T2M , 7TYP , 7TYQ , 7TYU , 8CUH , 8E1O , 8P29 , 8POJ , 8POM , 8PON , 8PUX , 8PUY , 8RXL , 8RXP , 8RXQ , 8RXV , 8RYC , 8YGQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01285	TEA	41 → 110	TEA/ATTS domain	Domain
PF17725	YBD	226 → 444	YAP binding domain	Domain

Sequence

MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK
DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPF
SQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPP
DAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVET
ERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL
LLCTAYVFEVSTSERGAQHHIYRLVRD

Sequence length

447

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway Hippo signaling pathway - multiple species		YAP1- and WWTR1 (TAZ)-stimulated gene expression RUNX3 regulates YAP1-mediated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32323824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35077390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36907523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25804118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33509776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	30794805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28548934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31402277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	1882842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12461749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	26923924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36907523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only

TEAD2 (TEA domain transcription factor 2)