Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	8462
Gene name	KLF transcription factor 11
Gene symbol	KLF11
Synonyms (NCBI Gene)	FKLFFKLF1MODY7TIEG2Tieg3
Chromosome	2
Chromosome location	2p25.1
Summary	The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34336420	C>G,T	Likely-benign, pathogenic, benign	Coding sequence variant, missense variant
rs121912645	G>T	Pathogenic	Coding sequence variant, missense variant

325

Show/Hide all (325)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016644	hsa-miR-429	Reporter assay	20005803
MIRT020284	hsa-miR-130b-3p	Sequencing	20371350
MIRT020356	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021077	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021660	hsa-miR-141-3p	Reporter assay	20005803
MIRT024132	hsa-miR-200b-3p	Reporter assay	20005803
MIRT028132	hsa-miR-93-5p	Sequencing	20371350
MIRT1095833	hsa-miR-103a	CLIP-seq
MIRT1095834	hsa-miR-106a	CLIP-seq
MIRT1095835	hsa-miR-106b	CLIP-seq
MIRT1095836	hsa-miR-107	CLIP-seq
MIRT1095837	hsa-miR-1184	CLIP-seq
MIRT1095838	hsa-miR-1224-3p	CLIP-seq
MIRT1095839	hsa-miR-1278	CLIP-seq
MIRT1095840	hsa-miR-1323	CLIP-seq
MIRT1095841	hsa-miR-141	CLIP-seq
MIRT1095842	hsa-miR-142-5p	CLIP-seq
MIRT1095843	hsa-miR-17	CLIP-seq
MIRT1095844	hsa-miR-1912	CLIP-seq
MIRT1095845	hsa-miR-200a	CLIP-seq
MIRT1095846	hsa-miR-20a	CLIP-seq
MIRT1095847	hsa-miR-20b	CLIP-seq
MIRT1095848	hsa-miR-214	CLIP-seq
MIRT1095849	hsa-miR-224	CLIP-seq
MIRT1095850	hsa-miR-28-3p	CLIP-seq
MIRT1095851	hsa-miR-3065-3p	CLIP-seq
MIRT1095852	hsa-miR-3160-5p	CLIP-seq
MIRT1095853	hsa-miR-3609	CLIP-seq
MIRT1095854	hsa-miR-3616-3p	CLIP-seq
MIRT1095855	hsa-miR-3619-5p	CLIP-seq
MIRT1095856	hsa-miR-377	CLIP-seq
MIRT1095857	hsa-miR-3925-3p	CLIP-seq
MIRT1095858	hsa-miR-3926	CLIP-seq
MIRT1095859	hsa-miR-3973	CLIP-seq
MIRT1095860	hsa-miR-4291	CLIP-seq
MIRT1095861	hsa-miR-4477a	CLIP-seq
MIRT1095862	hsa-miR-4645-5p	CLIP-seq
MIRT1095863	hsa-miR-4673	CLIP-seq
MIRT1095864	hsa-miR-4721	CLIP-seq
MIRT1095865	hsa-miR-4738-5p	CLIP-seq
MIRT1095866	hsa-miR-4742-5p	CLIP-seq
MIRT1095867	hsa-miR-4796-3p	CLIP-seq
MIRT1095868	hsa-miR-519a	CLIP-seq
MIRT1095869	hsa-miR-519b-3p	CLIP-seq
MIRT1095870	hsa-miR-519c-3p	CLIP-seq
MIRT1095871	hsa-miR-519d	CLIP-seq
MIRT1095872	hsa-miR-520g	CLIP-seq
MIRT1095873	hsa-miR-520h	CLIP-seq
MIRT1095874	hsa-miR-548a-3p	CLIP-seq
MIRT1095875	hsa-miR-548ah	CLIP-seq
MIRT1095876	hsa-miR-548e	CLIP-seq
MIRT1095877	hsa-miR-548f	CLIP-seq
MIRT1095878	hsa-miR-548o	CLIP-seq
MIRT1095879	hsa-miR-548p	CLIP-seq
MIRT1095880	hsa-miR-548s	CLIP-seq
MIRT1095881	hsa-miR-606	CLIP-seq
MIRT1095882	hsa-miR-761	CLIP-seq
MIRT1095883	hsa-miR-766	CLIP-seq
MIRT1095884	hsa-miR-922	CLIP-seq
MIRT1095885	hsa-miR-93	CLIP-seq
MIRT1095886	hsa-miR-939	CLIP-seq
MIRT1095840	hsa-miR-1323	CLIP-seq
MIRT1095887	hsa-miR-133a	CLIP-seq
MIRT1095888	hsa-miR-133b	CLIP-seq
MIRT1095889	hsa-miR-4652-3p	CLIP-seq
MIRT1095890	hsa-miR-4775	CLIP-seq
MIRT1095878	hsa-miR-548o	CLIP-seq
MIRT1095891	hsa-miR-590-3p	CLIP-seq
MIRT1095892	hsa-miR-1264	CLIP-seq
MIRT1095893	hsa-miR-1270	CLIP-seq
MIRT1095894	hsa-miR-1273g	CLIP-seq
MIRT1095895	hsa-miR-1283	CLIP-seq
MIRT1095896	hsa-miR-1305	CLIP-seq
MIRT1095897	hsa-miR-1324	CLIP-seq
MIRT1095849	hsa-miR-224	CLIP-seq
MIRT1095898	hsa-miR-3133	CLIP-seq
MIRT1095899	hsa-miR-3615	CLIP-seq
MIRT1095900	hsa-miR-361-5p	CLIP-seq
MIRT1095901	hsa-miR-3689d	CLIP-seq
MIRT1095856	hsa-miR-377	CLIP-seq
MIRT1095902	hsa-miR-380	CLIP-seq
MIRT1095903	hsa-miR-3942-3p	CLIP-seq
MIRT1095859	hsa-miR-3973	CLIP-seq
MIRT1095904	hsa-miR-421	CLIP-seq
MIRT1095905	hsa-miR-4330	CLIP-seq
MIRT1095906	hsa-miR-4457	CLIP-seq
MIRT1095907	hsa-miR-4464	CLIP-seq
MIRT1095908	hsa-miR-4494	CLIP-seq
MIRT1095909	hsa-miR-452	CLIP-seq
MIRT1095910	hsa-miR-4635	CLIP-seq
MIRT1095911	hsa-miR-4676-3p	CLIP-seq
MIRT1095912	hsa-miR-4683	CLIP-seq
MIRT1095913	hsa-miR-4694-3p	CLIP-seq
MIRT1095914	hsa-miR-4701-5p	CLIP-seq
MIRT1095915	hsa-miR-4709-5p	CLIP-seq
MIRT1095916	hsa-miR-4719	CLIP-seq
MIRT1095917	hsa-miR-4748	CLIP-seq
MIRT1095918	hsa-miR-4768-5p	CLIP-seq
MIRT1095919	hsa-miR-4802-5p	CLIP-seq
MIRT1095920	hsa-miR-485-3p	CLIP-seq
MIRT1095921	hsa-miR-494	CLIP-seq
MIRT1095922	hsa-miR-499a-5p	CLIP-seq
MIRT1095923	hsa-miR-520d-5p	CLIP-seq
MIRT1095872	hsa-miR-520g	CLIP-seq
MIRT1095873	hsa-miR-520h	CLIP-seq
MIRT1095924	hsa-miR-524-5p	CLIP-seq
MIRT1095925	hsa-miR-526b	CLIP-seq
MIRT1095926	hsa-miR-548l	CLIP-seq
MIRT1095927	hsa-miR-552	CLIP-seq
MIRT1095928	hsa-miR-582-5p	CLIP-seq
MIRT1095929	hsa-miR-588	CLIP-seq
MIRT1095881	hsa-miR-606	CLIP-seq
MIRT1095930	hsa-miR-620	CLIP-seq
MIRT1095931	hsa-miR-624	CLIP-seq
MIRT1095932	hsa-miR-873	CLIP-seq
MIRT2025716	hsa-miR-4668-3p	CLIP-seq
MIRT1095881	hsa-miR-606	CLIP-seq
MIRT1095834	hsa-miR-106a	CLIP-seq
MIRT1095835	hsa-miR-106b	CLIP-seq
MIRT2256896	hsa-miR-1193	CLIP-seq
MIRT1095838	hsa-miR-1224-3p	CLIP-seq
MIRT1095893	hsa-miR-1270	CLIP-seq
MIRT1095895	hsa-miR-1283	CLIP-seq
MIRT1095896	hsa-miR-1305	CLIP-seq
MIRT1095840	hsa-miR-1323	CLIP-seq
MIRT1095842	hsa-miR-142-5p	CLIP-seq
MIRT1095843	hsa-miR-17	CLIP-seq
MIRT1095844	hsa-miR-1912	CLIP-seq
MIRT2256897	hsa-miR-205	CLIP-seq
MIRT1095846	hsa-miR-20a	CLIP-seq
MIRT1095847	hsa-miR-20b	CLIP-seq
MIRT1095849	hsa-miR-224	CLIP-seq
MIRT1095850	hsa-miR-28-3p	CLIP-seq
MIRT2256898	hsa-miR-29a	CLIP-seq
MIRT2256899	hsa-miR-29b	CLIP-seq
MIRT2256900	hsa-miR-29c	CLIP-seq
MIRT1095851	hsa-miR-3065-3p	CLIP-seq
MIRT1095898	hsa-miR-3133	CLIP-seq
MIRT2256901	hsa-miR-3179	CLIP-seq
MIRT2256902	hsa-miR-3190	CLIP-seq
MIRT2256903	hsa-miR-3202	CLIP-seq
MIRT2256904	hsa-miR-329	CLIP-seq
MIRT2256905	hsa-miR-338-5p	CLIP-seq
MIRT1095853	hsa-miR-3609	CLIP-seq
MIRT1095900	hsa-miR-361-5p	CLIP-seq
MIRT1095854	hsa-miR-3616-3p	CLIP-seq
MIRT2256906	hsa-miR-362-3p	CLIP-seq
MIRT2256907	hsa-miR-3663-3p	CLIP-seq
MIRT1095901	hsa-miR-3689d	CLIP-seq
MIRT1095856	hsa-miR-377	CLIP-seq
MIRT2256908	hsa-miR-3936	CLIP-seq
MIRT1095859	hsa-miR-3973	CLIP-seq
MIRT1095904	hsa-miR-421	CLIP-seq
MIRT2256909	hsa-miR-425	CLIP-seq
MIRT2256910	hsa-miR-4282	CLIP-seq
MIRT2256911	hsa-miR-433	CLIP-seq
MIRT1095906	hsa-miR-4457	CLIP-seq
MIRT1095907	hsa-miR-4464	CLIP-seq
MIRT1095908	hsa-miR-4494	CLIP-seq
MIRT2256912	hsa-miR-4525	CLIP-seq
MIRT2256913	hsa-miR-4533	CLIP-seq
MIRT1095862	hsa-miR-4645-5p	CLIP-seq
MIRT2025716	hsa-miR-4668-3p	CLIP-seq
MIRT1095863	hsa-miR-4673	CLIP-seq
MIRT1095912	hsa-miR-4683	CLIP-seq
MIRT2256914	hsa-miR-4688	CLIP-seq
MIRT1095913	hsa-miR-4694-3p	CLIP-seq
MIRT1095915	hsa-miR-4709-5p	CLIP-seq
MIRT2256915	hsa-miR-4716-3p	CLIP-seq
MIRT1095916	hsa-miR-4719	CLIP-seq
MIRT1095864	hsa-miR-4721	CLIP-seq
MIRT2256916	hsa-miR-4731-3p	CLIP-seq
MIRT1095866	hsa-miR-4742-5p	CLIP-seq
MIRT1095917	hsa-miR-4748	CLIP-seq
MIRT1095867	hsa-miR-4796-3p	CLIP-seq
MIRT2256917	hsa-miR-4801	CLIP-seq
MIRT1095919	hsa-miR-4802-5p	CLIP-seq
MIRT1095922	hsa-miR-499a-5p	CLIP-seq
MIRT1095868	hsa-miR-519a	CLIP-seq
MIRT1095869	hsa-miR-519b-3p	CLIP-seq
MIRT1095870	hsa-miR-519c-3p	CLIP-seq
MIRT1095871	hsa-miR-519d	CLIP-seq
MIRT1095923	hsa-miR-520d-5p	CLIP-seq
MIRT1095872	hsa-miR-520g	CLIP-seq
MIRT1095873	hsa-miR-520h	CLIP-seq
MIRT1095924	hsa-miR-524-5p	CLIP-seq
MIRT2256918	hsa-miR-542-3p	CLIP-seq
MIRT1095874	hsa-miR-548a-3p	CLIP-seq
MIRT1095875	hsa-miR-548ah	CLIP-seq
MIRT1095876	hsa-miR-548e	CLIP-seq
MIRT1095877	hsa-miR-548f	CLIP-seq
MIRT1095878	hsa-miR-548o	CLIP-seq
MIRT1095879	hsa-miR-548p	CLIP-seq
MIRT2256919	hsa-miR-570	CLIP-seq
MIRT1095881	hsa-miR-606	CLIP-seq
MIRT1095930	hsa-miR-620	CLIP-seq
MIRT1095931	hsa-miR-624	CLIP-seq
MIRT2256920	hsa-miR-642b	CLIP-seq
MIRT1095885	hsa-miR-93	CLIP-seq
MIRT1095886	hsa-miR-939	CLIP-seq
MIRT1095834	hsa-miR-106a	CLIP-seq
MIRT1095835	hsa-miR-106b	CLIP-seq
MIRT2389876	hsa-miR-1262	CLIP-seq
MIRT1095840	hsa-miR-1323	CLIP-seq
MIRT1095842	hsa-miR-142-5p	CLIP-seq
MIRT1095843	hsa-miR-17	CLIP-seq
MIRT2389877	hsa-miR-1827	CLIP-seq
MIRT1095846	hsa-miR-20a	CLIP-seq
MIRT1095847	hsa-miR-20b	CLIP-seq
MIRT1095849	hsa-miR-224	CLIP-seq
MIRT2389878	hsa-miR-2682	CLIP-seq
MIRT2389879	hsa-miR-3125	CLIP-seq
MIRT2389880	hsa-miR-34a	CLIP-seq
MIRT2389881	hsa-miR-34c-5p	CLIP-seq
MIRT1095853	hsa-miR-3609	CLIP-seq
MIRT1095899	hsa-miR-3615	CLIP-seq
MIRT2389882	hsa-miR-3916	CLIP-seq
MIRT1095859	hsa-miR-3973	CLIP-seq
MIRT2389883	hsa-miR-4316	CLIP-seq
MIRT2389884	hsa-miR-449a	CLIP-seq
MIRT2389885	hsa-miR-449b	CLIP-seq
MIRT2389886	hsa-miR-449c	CLIP-seq
MIRT1095862	hsa-miR-4645-5p	CLIP-seq
MIRT1095863	hsa-miR-4673	CLIP-seq
MIRT2389887	hsa-miR-4701-3p	CLIP-seq
MIRT1095914	hsa-miR-4701-5p	CLIP-seq
MIRT2389888	hsa-miR-4710	CLIP-seq
MIRT1095916	hsa-miR-4719	CLIP-seq
MIRT1095866	hsa-miR-4742-5p	CLIP-seq
MIRT1095918	hsa-miR-4768-5p	CLIP-seq
MIRT1095867	hsa-miR-4796-3p	CLIP-seq
MIRT1095868	hsa-miR-519a	CLIP-seq
MIRT1095869	hsa-miR-519b-3p	CLIP-seq
MIRT1095870	hsa-miR-519c-3p	CLIP-seq
MIRT1095871	hsa-miR-519d	CLIP-seq
MIRT1095872	hsa-miR-520g	CLIP-seq
MIRT1095873	hsa-miR-520h	CLIP-seq
MIRT1095874	hsa-miR-548a-3p	CLIP-seq
MIRT1095875	hsa-miR-548ah	CLIP-seq
MIRT1095876	hsa-miR-548e	CLIP-seq
MIRT1095877	hsa-miR-548f	CLIP-seq
MIRT1095878	hsa-miR-548o	CLIP-seq
MIRT1095879	hsa-miR-548p	CLIP-seq
MIRT1095927	hsa-miR-552	CLIP-seq
MIRT1095929	hsa-miR-588	CLIP-seq
MIRT1095885	hsa-miR-93	CLIP-seq
MIRT1095892	hsa-miR-1264	CLIP-seq
MIRT2558360	hsa-miR-1297	CLIP-seq
MIRT2558361	hsa-miR-145	CLIP-seq
MIRT2558362	hsa-miR-194	CLIP-seq
MIRT1095849	hsa-miR-224	CLIP-seq
MIRT2558363	hsa-miR-23a	CLIP-seq
MIRT2558364	hsa-miR-23b	CLIP-seq
MIRT2558365	hsa-miR-23c	CLIP-seq
MIRT2558366	hsa-miR-26a	CLIP-seq
MIRT2558367	hsa-miR-26b	CLIP-seq
MIRT2558368	hsa-miR-3135	CLIP-seq
MIRT2558369	hsa-miR-3168	CLIP-seq
MIRT2558370	hsa-miR-3169	CLIP-seq
MIRT2558371	hsa-miR-3177-5p	CLIP-seq
MIRT2558372	hsa-miR-3185	CLIP-seq
MIRT2558373	hsa-miR-320e	CLIP-seq
MIRT2558374	hsa-miR-323-3p	CLIP-seq
MIRT2558375	hsa-miR-325	CLIP-seq
MIRT2256904	hsa-miR-329	CLIP-seq
MIRT2558376	hsa-miR-33a	CLIP-seq
MIRT2558377	hsa-miR-33b	CLIP-seq
MIRT2558378	hsa-miR-3613-3p	CLIP-seq
MIRT2256906	hsa-miR-362-3p	CLIP-seq
MIRT2558379	hsa-miR-3653	CLIP-seq
MIRT2558380	hsa-miR-3658	CLIP-seq
MIRT2256908	hsa-miR-3936	CLIP-seq
MIRT1095859	hsa-miR-3973	CLIP-seq
MIRT2256910	hsa-miR-4282	CLIP-seq
MIRT2558381	hsa-miR-4297	CLIP-seq
MIRT2558382	hsa-miR-4465	CLIP-seq
MIRT2558383	hsa-miR-4468	CLIP-seq
MIRT2558384	hsa-miR-4515	CLIP-seq
MIRT2558385	hsa-miR-4717-3p	CLIP-seq
MIRT1095916	hsa-miR-4719	CLIP-seq
MIRT2558386	hsa-miR-4722-5p	CLIP-seq
MIRT2558387	hsa-miR-4728-3p	CLIP-seq
MIRT2558388	hsa-miR-4729	CLIP-seq
MIRT2558389	hsa-miR-4763-5p	CLIP-seq
MIRT2558390	hsa-miR-4768-3p	CLIP-seq
MIRT2558391	hsa-miR-4774-3p	CLIP-seq
MIRT1095921	hsa-miR-494	CLIP-seq
MIRT2558392	hsa-miR-502-5p	CLIP-seq
MIRT1095872	hsa-miR-520g	CLIP-seq
MIRT1095873	hsa-miR-520h	CLIP-seq
MIRT2256918	hsa-miR-542-3p	CLIP-seq
MIRT2256919	hsa-miR-570	CLIP-seq
MIRT2558393	hsa-miR-581	CLIP-seq
MIRT1095891	hsa-miR-590-3p	CLIP-seq
MIRT2558394	hsa-miR-592	CLIP-seq
MIRT2558395	hsa-miR-597	CLIP-seq
MIRT2558396	hsa-miR-599	CLIP-seq
MIRT1095881	hsa-miR-606	CLIP-seq
MIRT2558397	hsa-miR-628-3p	CLIP-seq
MIRT2256920	hsa-miR-642b	CLIP-seq
MIRT2558398	hsa-miR-648	CLIP-seq
MIRT2558399	hsa-miR-802	CLIP-seq
MIRT2558400	hsa-miR-9	CLIP-seq
MIRT2558360	hsa-miR-1297	CLIP-seq
MIRT2558362	hsa-miR-194	CLIP-seq
MIRT2558363	hsa-miR-23a	CLIP-seq
MIRT2558364	hsa-miR-23b	CLIP-seq
MIRT2558365	hsa-miR-23c	CLIP-seq
MIRT2558366	hsa-miR-26a	CLIP-seq
MIRT2558367	hsa-miR-26b	CLIP-seq
MIRT2558371	hsa-miR-3177-5p	CLIP-seq
MIRT2558374	hsa-miR-323-3p	CLIP-seq
MIRT2558378	hsa-miR-3613-3p	CLIP-seq
MIRT2558379	hsa-miR-3653	CLIP-seq
MIRT2558380	hsa-miR-3658	CLIP-seq
MIRT2558382	hsa-miR-4465	CLIP-seq
MIRT2558383	hsa-miR-4468	CLIP-seq
MIRT2558386	hsa-miR-4722-5p	CLIP-seq
MIRT2558387	hsa-miR-4728-3p	CLIP-seq
MIRT2558388	hsa-miR-4729	CLIP-seq
MIRT2558394	hsa-miR-592	CLIP-seq
MIRT2558395	hsa-miR-597	CLIP-seq
MIRT2558396	hsa-miR-599	CLIP-seq
MIRT2558398	hsa-miR-648	CLIP-seq
MIRT2558399	hsa-miR-802	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NR1H4	Unknown	20060466
STAT3	Activation	18505768

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21171965
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	9748269
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	21171965
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	21171965
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9748269
GO:0005515	Function	Protein binding	IPI	17500595, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9748269
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005925	Component	Focal adhesion	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	21171965
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9748269
GO:0016604	Component	Nuclear body	IDA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	21171965
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	21171965

MIM	HGNC	e!Ensembl
603301	11811	ENSG00000172059

O14901

Protein name

Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)

Protein function

Transcription factor (PubMed:10207080, PubMed:9748269). Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth (PubMed:1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	394 → 418	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	424 → 448	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	454 → 476	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Higher expression in erythroid cells. {ECO:0000269|PubMed:10207080}.

Sequence

MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQR
SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTR
TPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTG
ESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGG
LLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMA
AGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK
KIPGWQAEVGKLNRIASAESPGSPLVSMPASA

Sequence length

512

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
KLF11-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MATURITY ONSET DIABETES MELLITUS IN YOUNG	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maturity-onset diabetes of the young	Benign; Uncertain significance; Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Maturity-onset diabetes of the young type 7	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar ClinVar, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MODY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	BEFREE	31146115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30899365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	28456933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29923255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31640084, 37199905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31498019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30602303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31612481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of pancreas	Pancreatic hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	22348086, 32524199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25502632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	32524199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15774581, 17130512, 23183531, 23555910, 26248217, 31124255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15774581, 17130512, 23042817, 23183531, 23555910, 26248217, 30602303, 31124255		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Diabetes Mellitus	Diabetes mellitus	Pubtator	15774581, 29758564, 33604390, 36208030	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15774581, 18199129, 19122346, 19843526, 22348086, 32741144, 35592779, 36208030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15774581, 17130512, 17931948, 18199129, 18505768, 18593768, 19122346, 19843526, 24586865, 31124255		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	23555910, 26935598, 27488034, 28372535, 28938437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25922306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27848055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24586865		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hyperglycemia	Hyperglycemia	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26248217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28456933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	20124487	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22428009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29375271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25502632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29923255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30509092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31498019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17114344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30509092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22318730, 23555910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	ORPHANET_DG	21844708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	23589285, 31124255		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maturity onset diabetes mellitus in young	Mason type diabetes	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Maturity onset diabetes mellitus in young	Mason type diabetes	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder)	Mason type diabetes	UNIPROT_DG	15774581		★★★★★ ★☆☆☆☆ Found in Text Mining only
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder)	Mason type diabetes	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder)	Mason type diabetes	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder)	Mason type diabetes	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	22318730, 23589285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	24885560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MODY	Mason type diabetes	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Monogenic Diabetes	BEFREE	29758564		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Monogenic Diabetes	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20002157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	23042817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17114344, 20002157, 20593487, 21171965, 22318730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17114344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17114344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	32524199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33571129	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30509092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient neonatal diabetes mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine Diseases	BEFREE	27488034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23555910, 25922306		★★★★★ ★☆☆☆☆ Found in Text Mining only

KLF11 (KLF transcription factor 11)