Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8458
Gene name	Transcription termination factor 2
Gene symbol	TTF2
Synonyms (NCBI Gene)	F2HuF2ZGRF6
Chromosome	1
Chromosome location	1p13.1
Summary	This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This pr

460

Show/Hide all (460)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024886	hsa-miR-215-5p	Microarray	19074876
MIRT026820	hsa-miR-192-5p	Microarray	19074876
MIRT032032	hsa-miR-16-5p	Proteomics	18668040
MIRT047031	hsa-miR-183-5p	CLASH	23622248
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	19536157
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT615614	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT645963	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT645962	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT645961	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT645960	hsa-miR-8055	HITS-CLIP	23824327
MIRT645959	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT645958	hsa-miR-541-5p	HITS-CLIP	23824327
MIRT645957	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645956	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645955	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT645954	hsa-miR-1290	HITS-CLIP	23824327
MIRT645953	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645952	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT645951	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645950	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645949	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT645948	hsa-miR-4282	HITS-CLIP	23824327
MIRT645947	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT645946	hsa-miR-1248	HITS-CLIP	23824327
MIRT645945	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT645944	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT645943	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT645942	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT509205	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509204	hsa-miR-105-5p	PAR-CLIP	23446348
MIRT509203	hsa-miR-7853-5p	PAR-CLIP	23446348
MIRT509202	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509201	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT509200	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509199	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT509198	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT509197	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT509196	hsa-miR-5095	PAR-CLIP	23446348
MIRT509195	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509194	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT456166	hsa-miR-9500	PAR-CLIP	23592263
MIRT456167	hsa-miR-1321	PAR-CLIP	23592263
MIRT456165	hsa-miR-4739	PAR-CLIP	23592263
MIRT456164	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT456163	hsa-miR-4270	PAR-CLIP	23592263
MIRT456162	hsa-miR-4441	PAR-CLIP	23592263
MIRT456160	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT456161	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT456159	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT456158	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT456157	hsa-miR-361-3p	PAR-CLIP	23592263
MIRT456156	hsa-miR-6077	PAR-CLIP	23592263
MIRT456155	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT456154	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT456153	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT456152	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT456151	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT456150	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT456149	hsa-miR-3175	PAR-CLIP	23592263
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	19536157
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	19536157
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	19536157
MIRT615614	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT645963	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT645962	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT645961	hsa-miR-27b-5p	HITS-CLIP	23824327
MIRT645960	hsa-miR-8055	HITS-CLIP	23824327
MIRT645959	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT645958	hsa-miR-541-5p	HITS-CLIP	23824327
MIRT645957	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT645956	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT645955	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT645954	hsa-miR-1290	HITS-CLIP	23824327
MIRT645953	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT645952	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT645951	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645950	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645949	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT645948	hsa-miR-4282	HITS-CLIP	23824327
MIRT645947	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT645946	hsa-miR-1248	HITS-CLIP	23824327
MIRT645945	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT645944	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT645943	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT645942	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT615617	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615616	hsa-miR-5007-3p	HITS-CLIP	23824327
MIRT615615	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT615614	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT509205	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509204	hsa-miR-105-5p	PAR-CLIP	23446348
MIRT509203	hsa-miR-7853-5p	PAR-CLIP	23446348
MIRT509202	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509201	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT509200	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509199	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT509198	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT509197	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT509196	hsa-miR-5095	PAR-CLIP	23446348
MIRT509195	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509194	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT456166	hsa-miR-9500	PAR-CLIP	23592263
MIRT456167	hsa-miR-1321	PAR-CLIP	23592263
MIRT456165	hsa-miR-4739	PAR-CLIP	23592263
MIRT456164	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT456163	hsa-miR-4270	PAR-CLIP	23592263
MIRT456162	hsa-miR-4441	PAR-CLIP	23592263
MIRT456160	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT456161	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT456159	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT456158	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT456157	hsa-miR-361-3p	PAR-CLIP	23592263
MIRT456156	hsa-miR-6077	PAR-CLIP	23592263
MIRT456155	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT456154	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT456153	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT456152	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT456151	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT456150	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT456149	hsa-miR-3175	PAR-CLIP	23592263
MIRT1462048	hsa-miR-1228	CLIP-seq
MIRT1462049	hsa-miR-1265	CLIP-seq
MIRT1462050	hsa-miR-127-5p	CLIP-seq
MIRT1462051	hsa-miR-143	CLIP-seq
MIRT1462052	hsa-miR-150	CLIP-seq
MIRT1462053	hsa-miR-1538	CLIP-seq
MIRT1462054	hsa-miR-193a-3p	CLIP-seq
MIRT1462055	hsa-miR-193a-5p	CLIP-seq
MIRT1462056	hsa-miR-193b	CLIP-seq
MIRT1462057	hsa-miR-1976	CLIP-seq
MIRT1462058	hsa-miR-203	CLIP-seq
MIRT1462059	hsa-miR-21	CLIP-seq
MIRT1462060	hsa-miR-2392	CLIP-seq
MIRT1462061	hsa-miR-300	CLIP-seq
MIRT1462062	hsa-miR-31	CLIP-seq
MIRT1462063	hsa-miR-3117-3p	CLIP-seq
MIRT1462064	hsa-miR-3128	CLIP-seq
MIRT1462065	hsa-miR-3133	CLIP-seq
MIRT1462066	hsa-miR-3157-5p	CLIP-seq
MIRT1462067	hsa-miR-3169	CLIP-seq
MIRT1462068	hsa-miR-3545-3p	CLIP-seq
MIRT1462069	hsa-miR-3646	CLIP-seq
MIRT1462070	hsa-miR-3653	CLIP-seq
MIRT1462071	hsa-miR-3663-5p	CLIP-seq
MIRT1462072	hsa-miR-3689a-5p	CLIP-seq
MIRT1462073	hsa-miR-3689b	CLIP-seq
MIRT1462074	hsa-miR-3689e	CLIP-seq
MIRT1462075	hsa-miR-3689f	CLIP-seq
MIRT1462076	hsa-miR-381	CLIP-seq
MIRT1462077	hsa-miR-4293	CLIP-seq
MIRT1462078	hsa-miR-4324	CLIP-seq
MIRT1462079	hsa-miR-4423-5p	CLIP-seq
MIRT1462080	hsa-miR-4438	CLIP-seq
MIRT1462081	hsa-miR-452	CLIP-seq
MIRT1462082	hsa-miR-4534	CLIP-seq
MIRT1462083	hsa-miR-4635	CLIP-seq
MIRT1462084	hsa-miR-4666-3p	CLIP-seq
MIRT1462085	hsa-miR-4676-3p	CLIP-seq
MIRT1462086	hsa-miR-4694-3p	CLIP-seq
MIRT1462087	hsa-miR-4709-3p	CLIP-seq
MIRT1462088	hsa-miR-4713-3p	CLIP-seq
MIRT1462089	hsa-miR-4722-3p	CLIP-seq
MIRT1462090	hsa-miR-4724-5p	CLIP-seq
MIRT1462091	hsa-miR-4727-5p	CLIP-seq
MIRT1462092	hsa-miR-4745-3p	CLIP-seq
MIRT1462093	hsa-miR-4757-5p	CLIP-seq
MIRT1462094	hsa-miR-4759	CLIP-seq
MIRT1462095	hsa-miR-4760-5p	CLIP-seq
MIRT1462096	hsa-miR-4765	CLIP-seq
MIRT1462097	hsa-miR-4769-3p	CLIP-seq
MIRT1462098	hsa-miR-4770	CLIP-seq
MIRT1462099	hsa-miR-4773	CLIP-seq
MIRT1462100	hsa-miR-4781-3p	CLIP-seq
MIRT1462101	hsa-miR-4797-5p	CLIP-seq
MIRT1462102	hsa-miR-499-3p	CLIP-seq
MIRT1462103	hsa-miR-508-3p	CLIP-seq
MIRT1462104	hsa-miR-518a-5p	CLIP-seq
MIRT1462105	hsa-miR-520g	CLIP-seq
MIRT1462106	hsa-miR-520h	CLIP-seq
MIRT1462107	hsa-miR-522	CLIP-seq
MIRT1462108	hsa-miR-527	CLIP-seq
MIRT1462109	hsa-miR-548an	CLIP-seq
MIRT1462110	hsa-miR-550b	CLIP-seq
MIRT1462111	hsa-miR-552	CLIP-seq
MIRT1462112	hsa-miR-562	CLIP-seq
MIRT1462113	hsa-miR-587	CLIP-seq
MIRT1462114	hsa-miR-590-5p	CLIP-seq
MIRT1462115	hsa-miR-606	CLIP-seq
MIRT1462116	hsa-miR-618	CLIP-seq
MIRT1462117	hsa-miR-892b	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT2138832	hsa-miR-1184	CLIP-seq
MIRT2138833	hsa-miR-1205	CLIP-seq
MIRT2138834	hsa-miR-1206	CLIP-seq
MIRT2138835	hsa-miR-1273f	CLIP-seq
MIRT1462050	hsa-miR-127-5p	CLIP-seq
MIRT2138836	hsa-miR-146a	CLIP-seq
MIRT2138837	hsa-miR-146b-5p	CLIP-seq
MIRT1462052	hsa-miR-150	CLIP-seq
MIRT2138838	hsa-miR-1909	CLIP-seq
MIRT1462057	hsa-miR-1976	CLIP-seq
MIRT1462059	hsa-miR-21	CLIP-seq
MIRT2138839	hsa-miR-2467-3p	CLIP-seq
MIRT1462061	hsa-miR-300	CLIP-seq
MIRT2138840	hsa-miR-3064-5p	CLIP-seq
MIRT1462063	hsa-miR-3117-3p	CLIP-seq
MIRT2138841	hsa-miR-3117-5p	CLIP-seq
MIRT2138842	hsa-miR-3125	CLIP-seq
MIRT2138843	hsa-miR-3148	CLIP-seq
MIRT1462066	hsa-miR-3157-5p	CLIP-seq
MIRT2138844	hsa-miR-3158-5p	CLIP-seq
MIRT1462067	hsa-miR-3169	CLIP-seq
MIRT2138845	hsa-miR-330-3p	CLIP-seq
MIRT1462069	hsa-miR-3646	CLIP-seq
MIRT2138846	hsa-miR-3652	CLIP-seq
MIRT1462070	hsa-miR-3653	CLIP-seq
MIRT2138847	hsa-miR-3678-3p	CLIP-seq
MIRT2138848	hsa-miR-3690	CLIP-seq
MIRT2138849	hsa-miR-378	CLIP-seq
MIRT2138850	hsa-miR-378b	CLIP-seq
MIRT2138851	hsa-miR-378c	CLIP-seq
MIRT2138852	hsa-miR-378d	CLIP-seq
MIRT2138853	hsa-miR-378e	CLIP-seq
MIRT2138854	hsa-miR-378f	CLIP-seq
MIRT2138855	hsa-miR-378h	CLIP-seq
MIRT2138856	hsa-miR-378i	CLIP-seq
MIRT1462076	hsa-miR-381	CLIP-seq
MIRT2138857	hsa-miR-3916	CLIP-seq
MIRT2138858	hsa-miR-3925-5p	CLIP-seq
MIRT2138859	hsa-miR-422a	CLIP-seq
MIRT2138860	hsa-miR-4254	CLIP-seq
MIRT1462077	hsa-miR-4293	CLIP-seq
MIRT2138861	hsa-miR-4310	CLIP-seq
MIRT1462078	hsa-miR-4324	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT2138862	hsa-miR-4422	CLIP-seq
MIRT2138863	hsa-miR-4430	CLIP-seq
MIRT2138864	hsa-miR-4505	CLIP-seq
MIRT2138865	hsa-miR-4511	CLIP-seq
MIRT1462084	hsa-miR-4666-3p	CLIP-seq
MIRT2138866	hsa-miR-4705	CLIP-seq
MIRT1462088	hsa-miR-4713-3p	CLIP-seq
MIRT2138867	hsa-miR-4713-5p	CLIP-seq
MIRT2138868	hsa-miR-4714-3p	CLIP-seq
MIRT1462089	hsa-miR-4722-3p	CLIP-seq
MIRT1462090	hsa-miR-4724-5p	CLIP-seq
MIRT1462091	hsa-miR-4727-5p	CLIP-seq
MIRT2138869	hsa-miR-4756-3p	CLIP-seq
MIRT1462093	hsa-miR-4757-5p	CLIP-seq
MIRT1462094	hsa-miR-4759	CLIP-seq
MIRT2138870	hsa-miR-4763-5p	CLIP-seq
MIRT1462097	hsa-miR-4769-3p	CLIP-seq
MIRT2138871	hsa-miR-4793-3p	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT2138872	hsa-miR-510	CLIP-seq
MIRT2138873	hsa-miR-512-5p	CLIP-seq
MIRT2138874	hsa-miR-520d-5p	CLIP-seq
MIRT1462105	hsa-miR-520g	CLIP-seq
MIRT1462106	hsa-miR-520h	CLIP-seq
MIRT2138875	hsa-miR-524-5p	CLIP-seq
MIRT2138876	hsa-miR-532-3p	CLIP-seq
MIRT1462111	hsa-miR-552	CLIP-seq
MIRT1462112	hsa-miR-562	CLIP-seq
MIRT2138877	hsa-miR-570	CLIP-seq
MIRT1462114	hsa-miR-590-5p	CLIP-seq
MIRT2138878	hsa-miR-604	CLIP-seq
MIRT2138879	hsa-miR-647	CLIP-seq
MIRT2138832	hsa-miR-1184	CLIP-seq
MIRT2138834	hsa-miR-1206	CLIP-seq
MIRT1462049	hsa-miR-1265	CLIP-seq
MIRT2359731	hsa-miR-1303	CLIP-seq
MIRT2138836	hsa-miR-146a	CLIP-seq
MIRT2138837	hsa-miR-146b-5p	CLIP-seq
MIRT1462052	hsa-miR-150	CLIP-seq
MIRT1462054	hsa-miR-193a-3p	CLIP-seq
MIRT1462056	hsa-miR-193b	CLIP-seq
MIRT1462057	hsa-miR-1976	CLIP-seq
MIRT1462058	hsa-miR-203	CLIP-seq
MIRT1462060	hsa-miR-2392	CLIP-seq
MIRT2138841	hsa-miR-3117-5p	CLIP-seq
MIRT2359732	hsa-miR-3123	CLIP-seq
MIRT2138843	hsa-miR-3148	CLIP-seq
MIRT2359733	hsa-miR-3152-3p	CLIP-seq
MIRT1462068	hsa-miR-3545-3p	CLIP-seq
MIRT2138846	hsa-miR-3652	CLIP-seq
MIRT2138848	hsa-miR-3690	CLIP-seq
MIRT2138849	hsa-miR-378	CLIP-seq
MIRT2138850	hsa-miR-378b	CLIP-seq
MIRT2138851	hsa-miR-378c	CLIP-seq
MIRT2138852	hsa-miR-378d	CLIP-seq
MIRT2138853	hsa-miR-378e	CLIP-seq
MIRT2138854	hsa-miR-378f	CLIP-seq
MIRT2138855	hsa-miR-378h	CLIP-seq
MIRT2138856	hsa-miR-378i	CLIP-seq
MIRT2359734	hsa-miR-3907	CLIP-seq
MIRT2359735	hsa-miR-3908	CLIP-seq
MIRT2138858	hsa-miR-3925-5p	CLIP-seq
MIRT2138859	hsa-miR-422a	CLIP-seq
MIRT2138860	hsa-miR-4254	CLIP-seq
MIRT2138861	hsa-miR-4310	CLIP-seq
MIRT2359736	hsa-miR-4312	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT2138863	hsa-miR-4430	CLIP-seq
MIRT1462082	hsa-miR-4534	CLIP-seq
MIRT1462084	hsa-miR-4666-3p	CLIP-seq
MIRT2138866	hsa-miR-4705	CLIP-seq
MIRT2138868	hsa-miR-4714-3p	CLIP-seq
MIRT1462089	hsa-miR-4722-3p	CLIP-seq
MIRT2359737	hsa-miR-4778-5p	CLIP-seq
MIRT2359738	hsa-miR-498	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT2138872	hsa-miR-510	CLIP-seq
MIRT2138873	hsa-miR-512-5p	CLIP-seq
MIRT2138877	hsa-miR-570	CLIP-seq
MIRT1462115	hsa-miR-606	CLIP-seq
MIRT2359739	hsa-miR-634	CLIP-seq
MIRT2359740	hsa-miR-875-3p	CLIP-seq
MIRT1462117	hsa-miR-892b	CLIP-seq
MIRT1462078	hsa-miR-4324	CLIP-seq
MIRT2138832	hsa-miR-1184	CLIP-seq
MIRT2138848	hsa-miR-3690	CLIP-seq
MIRT2138849	hsa-miR-378	CLIP-seq
MIRT2138850	hsa-miR-378b	CLIP-seq
MIRT2138851	hsa-miR-378c	CLIP-seq
MIRT2138852	hsa-miR-378d	CLIP-seq
MIRT2138853	hsa-miR-378e	CLIP-seq
MIRT2138854	hsa-miR-378f	CLIP-seq
MIRT2138855	hsa-miR-378h	CLIP-seq
MIRT2138856	hsa-miR-378i	CLIP-seq
MIRT2138859	hsa-miR-422a	CLIP-seq
MIRT2138860	hsa-miR-4254	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT2138868	hsa-miR-4714-3p	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT2138832	hsa-miR-1184	CLIP-seq
MIRT2138835	hsa-miR-1273f	CLIP-seq
MIRT1462051	hsa-miR-143	CLIP-seq
MIRT2138836	hsa-miR-146a	CLIP-seq
MIRT2138837	hsa-miR-146b-5p	CLIP-seq
MIRT2138839	hsa-miR-2467-3p	CLIP-seq
MIRT2138840	hsa-miR-3064-5p	CLIP-seq
MIRT1462062	hsa-miR-31	CLIP-seq
MIRT1462063	hsa-miR-3117-3p	CLIP-seq
MIRT1462064	hsa-miR-3128	CLIP-seq
MIRT2138844	hsa-miR-3158-5p	CLIP-seq
MIRT1462067	hsa-miR-3169	CLIP-seq
MIRT2138846	hsa-miR-3652	CLIP-seq
MIRT2138847	hsa-miR-3678-3p	CLIP-seq
MIRT2138858	hsa-miR-3925-5p	CLIP-seq
MIRT2653017	hsa-miR-3934	CLIP-seq
MIRT2653018	hsa-miR-409-5p	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT2653019	hsa-miR-4426	CLIP-seq
MIRT2138863	hsa-miR-4430	CLIP-seq
MIRT2138864	hsa-miR-4505	CLIP-seq
MIRT2653020	hsa-miR-4522	CLIP-seq
MIRT2653021	hsa-miR-4647	CLIP-seq
MIRT2653022	hsa-miR-4662b	CLIP-seq
MIRT2138866	hsa-miR-4705	CLIP-seq
MIRT2138868	hsa-miR-4714-3p	CLIP-seq
MIRT2138869	hsa-miR-4756-3p	CLIP-seq
MIRT1462094	hsa-miR-4759	CLIP-seq
MIRT1462098	hsa-miR-4770	CLIP-seq
MIRT1462102	hsa-miR-499-3p	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT1462111	hsa-miR-552	CLIP-seq
MIRT2138878	hsa-miR-604	CLIP-seq
MIRT2138879	hsa-miR-647	CLIP-seq
MIRT2653023	hsa-miR-764	CLIP-seq
MIRT2653024	hsa-miR-767-3p	CLIP-seq
MIRT2138834	hsa-miR-1206	CLIP-seq
MIRT2138835	hsa-miR-1273f	CLIP-seq
MIRT2138836	hsa-miR-146a	CLIP-seq
MIRT2138837	hsa-miR-146b-5p	CLIP-seq
MIRT2138839	hsa-miR-2467-3p	CLIP-seq
MIRT2138840	hsa-miR-3064-5p	CLIP-seq
MIRT2138841	hsa-miR-3117-5p	CLIP-seq
MIRT2138842	hsa-miR-3125	CLIP-seq
MIRT1462066	hsa-miR-3157-5p	CLIP-seq
MIRT2138844	hsa-miR-3158-5p	CLIP-seq
MIRT2138845	hsa-miR-330-3p	CLIP-seq
MIRT2138846	hsa-miR-3652	CLIP-seq
MIRT2138847	hsa-miR-3678-3p	CLIP-seq
MIRT2138857	hsa-miR-3916	CLIP-seq
MIRT2138858	hsa-miR-3925-5p	CLIP-seq
MIRT2653018	hsa-miR-409-5p	CLIP-seq
MIRT1462077	hsa-miR-4293	CLIP-seq
MIRT2138861	hsa-miR-4310	CLIP-seq
MIRT1462078	hsa-miR-4324	CLIP-seq
MIRT1555244	hsa-miR-4418	CLIP-seq
MIRT2138862	hsa-miR-4422	CLIP-seq
MIRT2653019	hsa-miR-4426	CLIP-seq
MIRT2138863	hsa-miR-4430	CLIP-seq
MIRT2138864	hsa-miR-4505	CLIP-seq
MIRT2653020	hsa-miR-4522	CLIP-seq
MIRT2653021	hsa-miR-4647	CLIP-seq
MIRT2653022	hsa-miR-4662b	CLIP-seq
MIRT1462084	hsa-miR-4666-3p	CLIP-seq
MIRT2138869	hsa-miR-4756-3p	CLIP-seq
MIRT1555245	hsa-miR-509-3-5p	CLIP-seq
MIRT1555246	hsa-miR-509-5p	CLIP-seq
MIRT2138872	hsa-miR-510	CLIP-seq
MIRT2138873	hsa-miR-512-5p	CLIP-seq
MIRT2138874	hsa-miR-520d-5p	CLIP-seq
MIRT2138875	hsa-miR-524-5p	CLIP-seq
MIRT1462111	hsa-miR-552	CLIP-seq
MIRT2138878	hsa-miR-604	CLIP-seq
MIRT2138879	hsa-miR-647	CLIP-seq
MIRT2653023	hsa-miR-764	CLIP-seq
MIRT2653024	hsa-miR-767-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	12927788, 17577209, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IBA
GO:0006353	Process	DNA-templated transcription termination	IEA
GO:0006353	Process	DNA-templated transcription termination	TAS	9748214
GO:0006369	Process	Termination of RNA polymerase II transcription	TAS	9748214
GO:0006397	Process	MRNA processing	IEA
GO:0008023	Component	Transcription elongation factor complex	TAS	9748214
GO:0008094	Function	ATP-dependent activity, acting on DNA	IBA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	9748214
GO:0008094	Function	ATP-dependent activity, acting on DNA	IEA
GO:0008094	Function	ATP-dependent activity, acting on DNA	TAS	9748214
GO:0008270	Function	Zinc ion binding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
604718	12398	ENSG00000116830

Q9UNY4

Protein name

Transcription termination factor 2 (EC 3.6.4.-) (Lodestar homolog) (RNA polymerase II termination factor) (Transcription release factor 2) (F2) (HuF2)

Protein function

DsDNA-dependent ATPase which acts as a transcription termination factor by coupling ATP hydrolysis with removal of RNA polymerase II from the DNA template. May contribute to mitotic transcription repression. May also be involved in pre-mRNA spli

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06839	zf-GRF	4 → 41	GRF zinc finger	Domain
PF00176	SNF2_N	573 → 933	SNF2 family N-terminal domain	Family
PF00271	Helicase_C	991 → 1106	Helicase conserved C-terminal domain	Family

Sequence

MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVEL
QGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSN
WLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSS
GLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKS
SGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGPLNKEYTNWEAKETKAKDGPS
IQATQKSLPQGHFQERPETHSVPAPGGPAAQAAPAAPGLSLGEGREAATSSDDEEEDDVV
FVSSKPGSPLLFDSTLDLETKENLQFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQ
LKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFT
KTTTGPPHLVPPQPLPRRGTQPVGSLELKSACQVTAGGSSQCYRGHTNQDHVHAVWKITS
EAIGQLHRSLESCPGETVVAEDPAGLKVPLLLHQKQALAWLLWRESQKPQGGILADDMGL
GKTLTMIALILTQKNQEKKEEKEKSTALTWLSKDDSCDFTSHGTLIICPASLIHHWKNEV
EKRVNSNKLRVYLYHGPNRDSRARVLSTYDIVITTYSLVAKEIPTNKQEAEIPGANLNVE
GTSTPLLRIAWARIILDEAHNVKNPRVQTSIAVCKLQACARWAVTGTPIQNNLLDMYSLL
KFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKSLLLRRTKDQLDSTGRPLVILPQRKF
QLHHLKLSEDEETVYNVFFARSRSALQSYLKRHESRGNQSGRSPNNPFSRVALEFGSEEP
RHSEAADSPRSSTVHILSQLLRLRQCCCHLSLLKSALDPMELKGEGLVLSLEEQLSALTL
SELRDSEPSSTVSLNGTFFKMELFEGMRESTKISSLLAELEAIQRNSASQKSVIVSQWTN
MLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQVMLISLLAGGVGLNLTGG
NHLFLLDMHWNPSLEDQACDRIYRVGQQKDVVIHRFVCEGTVEEKILQLQEKKKDLAKQV
LSGSGESVTKLTLADLRVLFGI

Sequence length

1162

Interactions

View interactions

	KEGG
	Thyroid hormone synthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (524)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	10091393, 10593555, 10650845, 10726047, 11328946, 11583311, 12032428, 12361206, 12571435, 12601492, 12680634, 15539375, 15609280, 15650545, 15706470 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	15534175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	9843168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	11741359, 15377476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute fatty liver of pregnancy	Fatty Liver	BEFREE	29297090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	25260809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15650545, 20546854, 29334169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	15474155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Mesenteric Arterial Embolus	Mesenteric Arterial Embolus	CTD_human_DG	24282370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Mesenteric Arterial Thrombosis	Mesenteric Arterial Thrombosis	CTD_human_DG	24282370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31686280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28222624, 30765164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29390508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31704834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28700408, 30682709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20546854, 29334169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28561879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Afibrinogenemia	Afibrinogenemia	Pubtator	10688828, 33668986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	29027065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21163861, 27553758, 30361890, 31197037, 8362984, 9258892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28869458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29499439, 30344141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11298605, 11535535, 11719358, 12560240, 22052675, 22084413, 31648337, 35822297, 9723576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	30344141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11146461, 16906320, 23992124, 8191393, 9723576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	10583928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	11741359, 15377476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	29102986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	10726001, 11085290, 19005247, 19101711, 22964766, 24093662, 27734511, 27807637, 28050648, 28116654, 28259966, 28647870, 28686816, 29402471, 29895622 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	10726001, 24175578, 34567006, 36012233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin Deficiency	BEFREE	10521764, 11071628, 11814516, 12894373, 14747183, 16055356, 16102025, 19242082, 23399370, 26304686, 27459142, 27613196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin deficiency	Pubtator	25811371, 32422680, 38309434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin deficiency	Pubtator	37201530, 37670493	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	27010400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	10360908, 10669148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	17985012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16778142, 19609209, 21918818, 28382527, 31035349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	24385683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	9008232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12176812, 18787303, 22674286, 24385683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24831437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15447683, 7650024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10027711, 15009462, 23335513, 26826018, 26915609, 27010400, 31467874, 37046189, 7806495, 8163952, 8226804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12048131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16778142, 19609209, 21918818, 28382527, 31035349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33874983	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	18452786	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18608122, 19998810, 28154247, 28638002, 30244598, 31642215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19459131, 24041930, 28747025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	28660462		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	29390508		★★★★★ ★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	16782234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10792380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	10685825, 10756370, 11128675, 12632020, 15077257, 16189654, 16601831, 21813062, 22495315, 23207285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	11820731, 15077257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	12780409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	8407908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	14717981		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10606878, 12560240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	30988349		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	9233563	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	30988349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	31061002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	10651742, 10706027, 10894919, 1174709, 17160994, 17188533, 19141155, 22632160, 24476525, 27428015, 27628534, 28062681, 28222949, 28292321, 28604569 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	11435303, 12149217, 12621026, 16230339, 17456629, 17509570, 19265041, 19652200, 20102484, 21488867, 2172989, 22419573, 22906349, 23411429, 24158387 View all (21 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	17492768, 26826018	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	CTD_human_DG	17721328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	40117674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders, Inherited	Blood Coagulation Disorders	BEFREE	23852823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10397718, 12361206, 19483159, 22543060, 26247237, 30410927, 32759504, 32761872, 3487353, 36179652, 3801671, 6546700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	12466243, 15201252, 18665927, 18979364, 22212092, 22459907, 23578283, 29284605, 29470443, 2981587, 32036486, 32218020, 32649856, 37563135, 6508753 View all (7 more)	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	30562971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain infarction	Pubtator	10567604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	12766367, 17525392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	14753426, 15534175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	17188740, 35197442, 35570827, 9572989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15033664, 16818854, 21822552, 25407022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10027305, 14966279, 15033664, 28187434, 31962001, 32854772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	23276942	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	11584361, 19223280, 24755609, 24793031, 26238013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	26181660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	20664062	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11861279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17695537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	18084247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21659380, 25591763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31962001	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20352429, 28148395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22065054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12008943, 12713146, 15879303, 16778142, 17883698, 21755116, 29760305, 9691139, 9776213, 9869153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26286125, 32649856, 35708029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	12871361, 15240970, 19353312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	18327410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	24385683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28667727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	12871361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	16782234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	28662718, 33175864, 33955515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	10572079, 17456629, 24355932, 25063764, 26286125, 32769241, 34087973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10593555, 10929044, 17525392, 18550588, 19263510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	15907528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	22098125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral sinovenous thrombosis	Cerebral Sinovenous Thrombosis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Thrombosis	Cerebral Thrombosis	BEFREE	20482605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10051291, 10365738, 10397694, 10468143, 10572079, 11168509, 12695749, 14681817, 15116266, 15370721, 15907528, 19005247, 19660184, 20947844, 21701789 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CLINVAR_DG	11443298, 15059842, 19652888, 27031503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	12695749, 15116266, 15947254, 15952132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	CTD_human_DG	15534175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	10929044, 19524925, 21755116, 7773734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	9572989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20546854, 29334169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	28561879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	BEFREE	9697705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31355160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	25992517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31243735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	30142800, 31343417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27734511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	10776921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10655279, 12684909, 15056097, 15740488, 15893284, 24793031, 25449247, 27615602, 27801884, 28520878, 28710435, 29361652, 30601338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	34609416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coagulation factor deficiency syndrome	Coagulation Factor Deficiency Syndrome	BEFREE	30312027, 31121073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19439852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	1517149, 8611404, 9820166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31704834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39212570	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31704834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12707033, 21907696, 30462538, 30542696, 33625532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27615602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	30747207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	12149217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	17330543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	31061002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	31271700	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	22643805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital factor II deficiency	Congenital Factor II Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	12165566, 15320969, 15863666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	7961868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29891045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10541274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	17188740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10070834, 11369682, 12204058, 14676252, 16675000, 17334933, 18452260, 19349859, 19829138, 21080082, 22703881, 9330434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10070834, 10929044, 11369682, 11741359, 12204058, 16503463, 16675000, 17334933, 18452260, 19349859, 19609209, 19829138, 21080082, 22703881, 9330434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10929044, 12204058, 15201277, 18278189, 18452260, 19353312, 20002542, 20626623, 32525847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	18278189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18278189, 22359579, 22388798, 23426025, 9292507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10070834, 11369682, 11741359, 12204058, 16503463, 16675000, 17334933, 18452260, 19349859, 19829138, 20737565, 21080082, 22703881, 31243735, 9330434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	12439145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	18387654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	35196304	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16201098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29348288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	22585010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystathionine beta-Synthase Deficiency Disease	Cystathionine Beta-Synthase Deficiency Disease	BEFREE	11486902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	1569186, 32668165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18346036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	10065893, 10073976, 10192660, 10477778, 10779003, 10904101, 10929044, 10930988, 10996828, 11114134, 11128675, 11380448, 11441986, 11533523, 11734663 View all (46 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	12296757, 19920886, 9869612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	19219640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19349859, 19356951, 26929264, 31391352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10468143, 19349859, 19356951, 26315791, 26929264, 31391352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15201277, 25298619	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19438723, 21935671, 22359579, 23426025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37537394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19755774, 26742564, 33441513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17982733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16138347, 19349859, 21935671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31371129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	11740383, 17697137, 27940211, 28288667, 29065752, 29178991, 29297090, 30064685, 30383650, 30453810, 30461646, 30918965, 31180918, 31442556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	CTD_human_DG	1894189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	29257196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	19399328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	29342468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysfibrinogenemia	Dysfibrinogenemia	BEFREE	12444311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysfibrinogenemia Congenital	Dysfibrinogenemia	Pubtator	8770228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysfibrinogenemia, Congenital	Congenital Dysfibrinogenemia	BEFREE	28922493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29224833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	11093048, 12628278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	11424123, 17439518, 30392460, 30565383		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	24124337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15755869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	15564733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	25992517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25992517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	28504002, 6424845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency, acquired	Factor VIII deficiency	BEFREE	30027013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor II deficiency	Factor II Deficiency	BEFREE	10354129, 12529749, 1334372, 14629473, 14962227, 15892853, 19141155, 29063359, 31623191, 6409139, 7740448, 9134629, 9351523, 9863703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor II deficiency	Factor II Deficiency	ORPHANET_DG	23852823, 25242243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	16359508, 18695002, 19861681, 33605529, 37866515, 7655011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	21320286	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor vii deficiency	Pubtator	12881304, 22426302, 40117674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor VII Deficiency	BEFREE	20885134, 28201865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor X Deficiency	BEFREE	12127953, 18374200, 19412729, 31667683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor x deficiency	Pubtator	18245654, 25179519, 34680916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor XI Deficiency	Factor xi deficiency	Pubtator	25911238, 9573017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor XII Deficiency	Factor xii deficiency	Pubtator	22419573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	20008134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28110063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	28767598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	10216089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17230606, 26226452, 28008144, 30392460, 30656542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	BEFREE	17525392, 19404532, 22784820, 22909823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	17380283, 19638731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	16098865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	28822718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17958740, 26459764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30880204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30880204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11956584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17958740, 33947134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	8163952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	29027065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	37563135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	17137471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22543060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30095652, 8245691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29891045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36179652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Congenital heart septal defect	Pubtator	20552683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	25711313		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	12725641, 12780341, 18568463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	31136528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	32311169	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	10651742, 11246535, 11869940, 12747585, 16015425, 19109232, 20169510, 22632160, 25428222, 2563663, 26635073, 26914731, 2713493, 28648539, 28944952 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	LHGDN	11869940, 16015425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	12487778, 1569180, 15705787, 16015425, 17059471, 19563500, 2104766, 21605333, 21899664, 21933309, 24485400, 2499363, 2506948, 3137981, 32430703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	18374200, 1871712, 26635073, 28222949, 28944952, 29135476, 3563965, 7404475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	2752109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	8427961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	10651742, 11246535, 12747585, 22632160, 25428222, 2563663, 26635073, 26914731, 2713493, 28648539, 29517971, 31006077, 31246563, 9873890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	11418471, 12149217, 17160994, 18055987, 18492116, 19563500, 19861681, 19959486, 21899664, 21933309, 22098125, 2298753, 25179519, 27975099, 29471734 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic disease	Pubtator	12149217, 16680739, 18245654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	22948176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	35302736	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	16791607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	37102605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	22906349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30957325, 31000773, 31712684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	11584361, 19223280, 24755609, 24793031, 26238013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	36243044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31240230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22174551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	1325077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor II deficiency disease	Hereditary Factor II Deficiency Disease	BEFREE	10627484, 11341500, 1334372, 14629473, 15284583, 15892853, 25242243, 3810561, 625142, 9490687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor II deficiency disease	Hereditary Factor II Deficiency Disease	ORPHANET_DG	23852823, 25242243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary factor II deficiency disease	Hereditary Factor II Deficiency Disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	28801214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36077307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21297956	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	27987016, 28727631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	15629370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25042561	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31360265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	10065893, 10460623, 12368166, 12428084, 15205587, 15726653, 15947544, 15947551, 17126889, 17510305, 18320477, 23337711, 24365371, 27734511, 9408013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	LHGDN	18360788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	18612269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	22628232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	25042561	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31144065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	30086576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26915609, 8888689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	36646026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11317134, 20601540, 21072525, 21918818, 23262933, 24189452, 26315791, 30095652, 31144065, 9708474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30571457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	20386430, 2455567, 28767598, 606560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	9721728	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoprothrombinemias	Hypoprothrombinemia	BEFREE	12529749, 1334372, 14629473, 15892853, 17160994, 19141155, 29063359, 31623191, 6409139, 7740448, 9134629, 9351523, 9863703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoprothrombinemias	Hypoprothrombinemia	CTD_human_DG	3567158, 7740448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoprothrombinemias	Hypoprothrombinemia	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35853902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Lamellar	Lamellar ichthyosis	Pubtator	11874482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31017730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25199049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11374681, 11383586, 11953689, 12454577, 15947544, 15947551, 16128949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29777136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	BEFREE	1334372, 14629473, 19141155, 23152198, 31623191, 7740448, 9134629, 9351523, 9863703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	UNIPROT_DG	1349838, 1354985, 1421398, 14962227, 2719946, 3242619, 3567158, 3771562, 3801671, 6405779, 7792730, 7865694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	LHGDN	15892853, 17002658, 18852482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	CLINVAR_DG	19289024, 9569177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	ORPHANET_DG	23852823, 25242243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inherited Factor II deficiency	Inherited Factor II Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26742564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11447011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	34183315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Sinus Thrombophlebitis	Intracranial Sinus Thrombophlebitis	CTD_human_DG	12269725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	16258669, 19022798, 23399370, 31025572, 32769241, 34137813, 37175682, 37442428, 9401066, 9632445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	12571435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	24175578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	11383586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	24175578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	10494665, 10572079, 10650850, 10739378, 11697722, 11779888, 11923626, 12048131, 14660985, 15116266, 15946211, 17098841, 17456629, 17670851, 18387982 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32769241, 35790427, 37165007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	25992517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	21067798, 23029076, 29569213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	16760910, 33441513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	6424845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	9922347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26657082, 29694446, 30289129, 31564926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11841792, 21873357, 22419573, 7510689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31686280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28126252, 28331025, 31158377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16080493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10728807, 1309675, 15867214, 18618228, 18803353, 19383345, 20422305, 20883676, 21744129, 21914071, 22554292, 24455683, 25959919, 26210849, 26753954 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12684661, 16998285, 16998292, 18927526, 19020747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	2821104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	10216089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10655279, 12684909, 15056097, 15740488, 15893284, 16493481, 18618228, 21779363, 24793031, 25115839, 25449247, 25595667, 25987440, 27615602, 27801884 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26785615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	18627609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	15162553, 29179518, 29754978, 30508896, 30521841, 31117157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	CTD_human_DG	18618250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	10950056, 28488376, 28566885, 30565383, 31219208, 31840655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31632546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	40601919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	16858010, 18342628, 19877031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	18342628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25861627	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37654207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	10629572, 15026314, 15056097, 15934123, 16055356, 18827269, 19937485, 22664050, 22893315, 26864875, 27459142, 29320972, 30099593, 30891041, 31102433, 31165409 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	29582922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12139749, 15247980, 16221206, 21239755, 23141924, 33874983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	29582922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11529632, 14550881, 15026314, 15049712, 15247980, 21239755, 29582922, 30008452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	29582922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15033664, 16818854, 21822552, 25407022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19713246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28561879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16080493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23169292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16830369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	11325833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10064667, 15667542, 15701913, 16830369, 17106650, 17988232, 18591179, 18682947, 22925132, 23358198, 29499439, 29611057, 29948445, 31108555, 31223261, 31355160, 31704834 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	9934985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25163932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20505748, 26504080	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesenteric vascular insufficiency	Mesenteric Vascular Insufficiency	BEFREE	10505734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenteric vascular insufficiency	Mesenteric Vascular Insufficiency	CTD_human_DG	24282370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20724652, 32093387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23262933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25158985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	10655323, 11843387, 12042290, 12447960, 15006834, 16138341, 16194196, 16431900, 17145624, 18754836, 21259017, 22990475, 23795816, 27525841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23303820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	19804471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16080493, 28339463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31752723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33086557, 34561786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	632237	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24410667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27734511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	11991237, 19438723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10027711, 10051291, 10195931, 10381497, 10404757, 10468143, 10987590, 11741359, 11748101, 12439145, 12480694, 12877676, 12888875, 14523329, 14660985 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	10027711, 9292507, 9531249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10027711, 10381497, 10987590, 12480694, 16015425, 16649726, 18387978, 21958997, 23382263, 25693916, 9292507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15952132, 16015425, 16988555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18278189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	10583928, 17456629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	14676252, 19027114, 19524925, 8245691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35271862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31210089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10915729, 24965572, 25496996, 26210849, 28168546, 28314929, 28554226, 28679433, 28796412, 28888776, 29340726, 29374740, 30467039, 31186786, 31187326, 31210089, 31558668, 31764406, 7520347 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	21067798, 23029076, 29569213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	26353961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	BEFREE	15592049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	CTD_human_DG	18541230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	9835442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	29292076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22381244, 27553758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28331025, 31158377		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Non rare thrombophilia	Non Rare Thrombophilia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	22841818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	22841818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	18796459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonocclusive Mesenteric Ischemia	Nonocclusive Mesenteric Ischemia	CTD_human_DG	24282370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17897305, 20400894, 21797965, 26315791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19228864, 20148880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	22841818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	20102484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Occlusive Mesenteric Arterial Ischemia	Occlusive Mesenteric Arterial Ischemia	CTD_human_DG	24282370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23289928, 24385683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	20378562	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	23826780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ostium secundum atrial septal defect	Secundum atrial septal defect	BEFREE	17525392, 19404532, 22784820, 22909823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	15066453, 19022798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15839837, 20352429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23169292, 29682191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22132114, 28573829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11950817, 16981266, 20543535, 22132114, 28573829, 31525466, 35723281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28126252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	11325833, 23327367, 26356687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	CTD_human_DG	22633222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paresis	Paresis	Pubtator	16258669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16410750, 26440368, 29422542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21163861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	27734511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	29342468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	10776921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	15768007, 15886665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	15768007, 15886665, 19356951, 26092622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	14660985, 19356951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	LHGDN	15304039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petrous Sinus Thrombophlebitis	Petrous Sinus Thrombophlebitis	CTD_human_DG	12269725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petrous Sinus Thrombosis	Petrous Sinus Thrombosis	CTD_human_DG	12269725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	27345569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11821270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	17454173, 31173497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	15749677, 23828072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	18768782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	21442635	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	11454529, 11734671, 14550881, 24093662, 27807637, 29895622, 30079071, 30255283, 31090599, 31234212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	11122096, 11584361, 15094219, 15947552, 16283309, 16493481, 18392325, 18618228, 24793031, 25115839, 28465646, 29178991, 31764406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15650545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	8333868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	29102986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	29617690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15143072, 16052512, 17492768, 23773523, 32692888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	10029588, 10521389, 10567604, 10572079, 10650850, 10650856, 10744139, 12592605, 16055356, 20012238, 26400660, 26612425, 30963470, 9890720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	LHGDN	19190829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein S Deficiency	Protein S Deficiency	BEFREE	10669162, 10847418, 11555702, 11978272, 12038778, 12151426, 12506156, 1535736, 15726653, 15832907, 16055356, 16102025, 16469858, 22198364, 23026651, 27613196, 27734511, 8815575 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	33441513	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21624643, 32758992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	12023853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	BEFREE	11734663, 12165282, 18160588, 18586684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura Fulminans	Purpura Fulminans	BEFREE	10599098, 12601492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	31791152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Pyruvate Carboxylase Deficiency Disease	BEFREE	11694407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10541274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29194072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	606560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27892596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Artery Occlusion	Retinal Artery Occlusion	BEFREE	11994569, 12928685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	11549610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	11450488, 11820306, 23289804, 24630828, 28085519, 28085526, 30970085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	10794366, 27018927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29617690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	26001728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	7507301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	25821032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	15201277	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	22842493, 31054328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15839991, 25239655, 28588245, 28950719, 29848060, 30985959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sheehan Syndrome	Sheehan Syndrome	BEFREE	27425780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	9332318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	CTD_human_DG	12269725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	14579793, 17245631, 17433691, 19439852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	LHGDN	17433691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases Genetic	Skin disease	Pubtator	16374478	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases, Vascular	Skin Diseases, Vascular	CTD_human_DG	17535202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17610004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32036486, 35853902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	22065054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27841803		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29695176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	20008134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16830369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26823721, 36189305, 38106450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	12871361, 15247980, 18627609, 24189452, 26286125, 31271700, 32649856, 37673933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35790427	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	19826759, 30417687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcortical Infarction	Brain Infarction	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	9332318		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	9332318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	18550588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	2539213, 6826726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	18768782, 23243278, 23873831, 31856623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	21442635, 24009132	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	15749677, 16563815, 19223280, 23828072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	23873831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	28747069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	11151062, 11167771, 12469051, 12749008, 16432849, 19022798, 19414836, 19438723, 30268122, 9861761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	10070829, 10477778, 10494665, 10521389, 10530716, 10650856, 10726001, 10739378, 10741896, 10759012, 10759281, 10774459, 10775030, 10852421, 10887932 View all (97 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	10460623, 10898280, 11151062, 11190900, 15059842, 15497023, 1634610, 17262091, 17454173, 17456620, 17461930, 17895509, 18160613, 19414836, 19508974 View all (29 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	CTD_human_DG	16628723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	21370218, 33923802, 35822297, 9326350	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia hereditary	Thrombophilia	Pubtator	10477778, 11151062, 16760910, 18840629, 23114529, 28075532, 36017017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	11426488, 12871277, 15630669, 16015425, 23795816, 24162564, 27058219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	10027711, 10194441, 10394164, 10440914, 10477778, 10666427, 10725983, 10779421, 10929044, 11151062, 11167765, 12044337, 12139755, 12296757, 12361206 View all (63 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	11532562, 12761462, 15528884, 16155788, 19022798, 20482605, 23399370, 27031503, 28869458, 29402471, 9632445, 9660394, 9731592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	16015153, 19448164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Agenesis	Thyroid Agenesis	BEFREE	12165566, 9697705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23327367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11325833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	34751390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	15320969, 20453517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid hemiagenesis	Thyroid hemiagenesis	BEFREE	15320969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11325833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	1569192, 21320286, 25179519, 34680916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	9864932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	LHGDN	15947254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	9731592, 9864932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	12032428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11383586, 19439852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	12165566, 15320969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	15947552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10669148, 9890720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16760910, 22359579, 23426025, 32382091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	1328304	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	15817447, 17728394, 32430703, 7806495, 8163952, 8226804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	10029588, 10567604, 10666427, 10779421, 10930988, 10987590, 11071624, 11153741, 11167765, 11380448, 11471205, 12239149, 12447958, 12871543, 12871547 View all (57 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	10027711, 10233439, 10477778, 10725983, 10929044, 11071624, 11151062, 11190909, 11229520, 11380448, 11441986, 12044337, 12067473, 12139755, 12296757 View all (50 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	16649726, 22992348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	10631643, 10739378, 10861823, 16155788, 16258669, 21350198, 22527222, 28869458, 30005273, 9731592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin K Deficiency	Vitamin k deficiency	Pubtator	33849479	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	29193875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	19959486		★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 3	Von willebrand disorder	Pubtator	30836803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	7901207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TTF2 (transcription termination factor 2)